Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTGHPAV6)

• DOT Name: Junctional adhesion molecule A (F11R)
• Synonyms: JAM-A; Junctional adhesion molecule 1; JAM-1; Platelet F11 receptor; Platelet adhesion molecule 1; PAM-1; CD antigen CD321
• Gene Name: F11R
• UniProt ID: JAM1_HUMAN
• PDB ID: 1NBQ; 3EOY; 3TSZ; 4ODB
• Pfam ID: PF13927 ; PF07686
• Sequence:
  MGTKAQVERKLLCLFILAILLCSLALGSVTVHSSEPEVRIPENNPVKLSCAYSGFSSPRV
  EWKFDQGDTTRLVCYNNKITASYEDRVTFLPTGITFKSVTREDTGTYTCMVSEEGGNSYG
  EVKVKLIVLVPPSKPTVNIPSSATIGNRAVLTCSEQDGSPPSEYTWFKDGIVMPTNPKST
  RAFSNSSYVLNPTTGELVFDPLSASDTGEYSCEARNGYGTPMTSNAVRMEAVERNVGVIV
  AAVLVTLILLGILVFGIWFAYSRGHFDRTKKGTSSKKVIYSQPSARSEGEFKQTSSFLV
• Function: Seems to play a role in epithelial tight junction formation. Appears early in primordial forms of cell junctions and recruits PARD3. The association of the PARD6-PARD3 complex may prevent the interaction of PARD3 with JAM1, thereby preventing tight junction assembly. Plays a role in regulating monocyte transmigration involved in integrity of epithelial barrier. Ligand for integrin alpha-L/beta-2 involved in memory T-cell and neutrophil transmigration. Involved in platelet activation ; (Microbial infection) Acts as a receptor for Mammalian reovirus sigma-1; (Microbial infection) Acts as a receptor for Human Rotavirus strain Wa.
• Tissue Specificity: Expressed in endothelium, epithelium and leukocytes (at protein level).
• KEGG Pathway:
  Cell adhesion molecules (hsa04514)
  Tight junction (hsa04530)
  Leukocyte transendothelial migration (hsa04670)
  Epithelial cell sig.ling in Helicobacter pylori infection (hsa05120)
• Reactome Pathway:
  Integrin cell surface interactions (R-HSA-216083)
  TGF-beta receptor signaling in EMT (epithelial to mesenchymal transition) (R-HSA-2173791)
  Tight junction interactions (R-HSA-420029)
  Cell surface interactions at the vascular wall (R-HSA-202733)

Molecular Interaction Atlas (MIA) of This DOT

21 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Junctional adhesion molecule A (F11R).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Junctional adhesion molecule A (F11R).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Junctional adhesion molecule A (F11R).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Junctional adhesion molecule A (F11R).	[4]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Junctional adhesion molecule A (F11R).	[5]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Junctional adhesion molecule A (F11R).	[6]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Junctional adhesion molecule A (F11R).	[7]
Selenium	DM25CGV	Approved	Selenium increases the expression of Junctional adhesion molecule A (F11R).	[8]
Etoposide	DMNH3PG	Approved	Etoposide increases the expression of Junctional adhesion molecule A (F11R).	[10]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Junctional adhesion molecule A (F11R).	[11]
SB-431542	DM0YOXQ	Preclinical	SB-431542 increases the expression of Junctional adhesion molecule A (F11R).	[13]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Junctional adhesion molecule A (F11R).	[14]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Junctional adhesion molecule A (F11R).	[15]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Junctional adhesion molecule A (F11R).	[16]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Junctional adhesion molecule A (F11R).	[17]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Junctional adhesion molecule A (F11R).	[18]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A increases the expression of Junctional adhesion molecule A (F11R).	[11]
QUERCITRIN	DM1DH96	Investigative	QUERCITRIN affects the expression of Junctional adhesion molecule A (F11R).	[19]
Tributylstannanyl	DMHN7CB	Investigative	Tributylstannanyl decreases the expression of Junctional adhesion molecule A (F11R).	[11]
Nitrobenzanthrone	DMN6L70	Investigative	Nitrobenzanthrone decreases the expression of Junctional adhesion molecule A (F11R).	[20]
diarylpropionitril	DM14X29	Investigative	diarylpropionitril increases the expression of Junctional adhesion molecule A (F11R).	[21]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Fulvestrant	DM0YZC6	Approved	Fulvestrant decreases the methylation of Junctional adhesion molecule A (F11R).	[9]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Junctional adhesion molecule A (F11R).	[12]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [4] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [5] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [6] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [7] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [8] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [9] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [10] Cell death mechanisms of the anti-cancer drug etoposide on human cardiomyocytes isolated from pluripotent stem cells. Arch Toxicol. 2018 Apr;92(4):1507-1524.
• [11] Inhibition of CXCL12-mediated chemotaxis of Jurkat cells by direct immunotoxicants. Arch Toxicol. 2016 Jul;90(7):1685-94. doi: 10.1007/s00204-015-1585-7. Epub 2015 Aug 28.
• [12] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [13] Activin/nodal signaling switches the terminal fate of human embryonic stem cell-derived trophoblasts. J Biol Chem. 2015 Apr 3;290(14):8834-48.
• [14] Low-dose Bisphenol A exposure alters the functionality and cellular environment in a human cardiomyocyte model. Environ Pollut. 2023 Oct 15;335:122359. doi: 10.1016/j.envpol.2023.122359. Epub 2023 Aug 9.
• [15] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [16] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [17] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [18] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [19] Molecular mechanisms of quercitrin-induced apoptosis in non-small cell lung cancer. Arch Med Res. 2014 Aug;45(6):445-54.
• [20] 3-Nitrobenzanthrone promotes malignant transformation in human lung epithelial cells through the epiregulin-signaling pathway. Cell Biol Toxicol. 2022 Oct;38(5):865-887. doi: 10.1007/s10565-021-09612-1. Epub 2021 May 25.
• [21] Oestradiol decreases colonic permeability through oestrogen receptor beta-mediated up-regulation of occludin and junctional adhesion molecule-A in epithelial cells. J Physiol. 2009 Jul 1;587(Pt 13):3317-28. doi: 10.1113/jphysiol.2009.169300. Epub 2009 May 11.