Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTGNYS0J)

• DOT Name: Transmembrane protein 185B (TMEM185B)
• Synonyms: Protein FAM11B
• Gene Name: TMEM185B
• UniProt ID: T185B_HUMAN
• Pfam ID: PF10269
• Sequence:
  MNPRGLFQDFNPSKFLIYTCLLLFSVLLPLRLDGIIQWSYWAVFAPIWLWKLLVVAGASV
  GAGVWARNPRYRTEGEACVEFKAMLIAVGIHLLLLMFEVLVCDRVERGTHFWLLVFMPLF
  FVSPVSVAACVWGFRHDRSLELEILCSVNILQFIFIALKLDRIIHWPWLVVFVPLWILMS
  FLCLVVLYYIVWSLLFLRSLDVVAEQRRTHVTMAISWITIVVPLLTFEVLLVHRLDGHNT
  FSYVSIFVPLWLSLLTLMATTFRRKGGNHWWFGIRRDFCQFLLEIFPFLREYGNISYDLH
  HEDSEDAEETSVPEAPKIAPIFGKKARVVITQSPGKYVPPPPKLNIDMPD

Molecular Interaction Atlas (MIA) of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Transmembrane protein 185B (TMEM185B).	[1]

15 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Transmembrane protein 185B (TMEM185B).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Transmembrane protein 185B (TMEM185B).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Transmembrane protein 185B (TMEM185B).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Transmembrane protein 185B (TMEM185B).	[5]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Transmembrane protein 185B (TMEM185B).	[6]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Transmembrane protein 185B (TMEM185B).	[7]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Transmembrane protein 185B (TMEM185B).	[8]
Etoposide	DMNH3PG	Approved	Etoposide decreases the expression of Transmembrane protein 185B (TMEM185B).	[6]
Mitomycin	DMH0ZJE	Approved	Mitomycin decreases the expression of Transmembrane protein 185B (TMEM185B).	[6]
Colchicine	DM2POTE	Approved	Colchicine decreases the expression of Transmembrane protein 185B (TMEM185B).	[6]
Hydroxyurea	DMOQVU9	Approved	Hydroxyurea decreases the expression of Transmembrane protein 185B (TMEM185B).	[6]
Adenine	DMZLHKJ	Approved	Adenine decreases the expression of Transmembrane protein 185B (TMEM185B).	[6]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Transmembrane protein 185B (TMEM185B).	[9]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Transmembrane protein 185B (TMEM185B).	[2]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Transmembrane protein 185B (TMEM185B).	[10]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [4] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [5] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [6] Utilization of CDKN1A/p21 gene for class discrimination of DNA damage-induced clastogenicity. Toxicology. 2014 Jan 6;315:8-16. doi: 10.1016/j.tox.2013.10.009. Epub 2013 Nov 6.
• [7] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [8] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [9] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [10] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.