Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTGR1KA4)

DOT Name Immunoglobulin superfamily DCC subclass member 3 (IGDCC3)
Synonyms Putative neuronal cell adhesion molecule
Gene Name IGDCC3
Related Disease
Breast cancer ( )
Breast carcinoma ( )
Colorectal carcinoma ( )
UniProt ID
IGDC3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00041 ; PF07679 ; PF13927
Sequence
MAVQRAASPRRPPAPLWPRLLLPLLLLLLPAPSEGLGHSAELAFAVEPSDDVAVPGQPIV
LDCRVEGTPPVRITWRKNGVELPESTHSTLLANGSLMIRHFRLEPGGSPSDEGDYECVAQ
NRFGLVVSRKARIQAATMSDFHVHPQATVGEEGGVARFQCQIHGLPKPLITWEKNRVPID
TDNERYTLLPKGVLQITGLRAEDGGIFHCVASNIASIRISHGARLTVSGSGSGAYKEPAI
LVGPENLTLTVHQTAVLECVATGNPRPIVSWSRLDGRPIGVEGIQVLGTGNLIISDVTVQ
HSGVYVCAANRPGTRVRRTAQGRLVVQAPAEFVQHPQSISRPAGTTAMFTCQAQGEPPPH
VTWLKNGQVLGPGGHVRLKNNNSTLTISGIGPEDEAIYQCVAENSAGSSQASARLTVLWA
EGLPGPPRNVRAVSVSSTEVRVSWSEPLANTKEIIGYVLHIRKAADPPELEYQEAVSKST
FQHLVSDLEPSTAYSFYIKAYTPRGASSASVPTLASTLGEAPAPPPLSVRVLGSSSLQLL
WEPWPRLAQHEGGFKLFYRPASKTSFTGPILLPGTVSSYNLSQLDPTAVYEVKLLAYNQH
GDGNATVRFVSLRGASERTALSPPCDCRKEEAANQTSTTGIVIGIHIGVTCIIFCVLFLL
FGQRGRVLLCKDVENQLSPPQGPRSQRDPGILALNGARRGQRGQLGRDEKRVDMKELEQL
FPPASAAGQPDPRPTQDPAAPAPCEETQLSVLPLQGCGLMEGKTTEAKTTEATAPCAGLA
AAPPPPDGGPGLLSEGQASRPAAARVTQPAHSEQ

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Breast cancer DIS7DPX1 Strong Biomarker [1]
Breast carcinoma DIS2UE88 Strong Biomarker [1]
Colorectal carcinoma DIS5PYL0 Strong Posttranslational Modification [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
15 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Immunoglobulin superfamily DCC subclass member 3 (IGDCC3). [3]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Immunoglobulin superfamily DCC subclass member 3 (IGDCC3). [4]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Immunoglobulin superfamily DCC subclass member 3 (IGDCC3). [5]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Immunoglobulin superfamily DCC subclass member 3 (IGDCC3). [6]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Immunoglobulin superfamily DCC subclass member 3 (IGDCC3). [7]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Immunoglobulin superfamily DCC subclass member 3 (IGDCC3). [8]
Marinol DM70IK5 Approved Marinol increases the expression of Immunoglobulin superfamily DCC subclass member 3 (IGDCC3). [9]
Panobinostat DM58WKG Approved Panobinostat increases the expression of Immunoglobulin superfamily DCC subclass member 3 (IGDCC3). [10]
Azathioprine DMMZSXQ Approved Azathioprine decreases the expression of Immunoglobulin superfamily DCC subclass member 3 (IGDCC3). [11]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Immunoglobulin superfamily DCC subclass member 3 (IGDCC3). [12]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Immunoglobulin superfamily DCC subclass member 3 (IGDCC3). [13]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Immunoglobulin superfamily DCC subclass member 3 (IGDCC3). [14]
Bisphenol A DM2ZLD7 Investigative Bisphenol A affects the expression of Immunoglobulin superfamily DCC subclass member 3 (IGDCC3). [15]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Immunoglobulin superfamily DCC subclass member 3 (IGDCC3). [16]
methyl p-hydroxybenzoate DMO58UW Investigative methyl p-hydroxybenzoate increases the expression of Immunoglobulin superfamily DCC subclass member 3 (IGDCC3). [17]
------------------------------------------------------------------------------------
⏷ Show the Full List of 15 Drug(s)

References

1 Extracellular matrix signature identifies breast cancer subgroups with different clinical outcome.J Pathol. 2008 Feb;214(3):357-67. doi: 10.1002/path.2278.
2 Distinct epigenetic signatures elucidate enhancer-gene relationships that delineate CIMP and non-CIMP colorectal cancers.Oncotarget. 2016 May 10;7(19):28027-39. doi: 10.18632/oncotarget.8473.
3 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
4 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
5 Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
6 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
7 Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
8 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
9 THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
10 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
11 A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
12 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
13 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
14 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
15 Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
16 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
17 Comparison of the global gene expression profiles produced by methylparaben, n-butylparaben and 17beta-oestradiol in MCF7 human breast cancer cells. J Appl Toxicol. 2007 Jan-Feb;27(1):67-77. doi: 10.1002/jat.1200.