Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTH18ZIC)

• DOT Name: RWD domain-containing protein 4 (RWDD4)
• Synonyms: Protein FAM28A
• Gene Name: RWDD4
• Related Disease:
  Prostate cancer
  Prostate carcinoma
  Bladder cancer
  Urinary bladder cancer
  Urinary bladder neoplasm
• UniProt ID: RWDD4_HUMAN
• Pfam ID: PF05773
• Sequence:
  MSANEDQEMELEALRSIYEGDESFRELSPVSFQYRIGENGDPKAFLIEISWTETYPQTPP
  ILSMNAFFNNTISSAVKQSILAKLQEAVEANLGTAMTYTLFEYAKDNKEQFMENHNPINS
  ATSISNIISIETPNTAPSSKKKDKKEQLSKAQKRKLADKTDHKGELPRGWNWVDVVKHLS
  KTGSKDDE

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Prostate cancer	DISF190Y	Strong	Altered Expression	[1]
Prostate carcinoma	DISMJPLE	Strong	Altered Expression	[1]
Bladder cancer	DISUHNM0	Limited	Biomarker	[2]
Urinary bladder cancer	DISDV4T7	Limited	Biomarker	[2]
Urinary bladder neoplasm	DIS7HACE	Limited	Biomarker	[2]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of RWD domain-containing protein 4 (RWDD4).	[3]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of RWD domain-containing protein 4 (RWDD4).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of RWD domain-containing protein 4 (RWDD4).	[5]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of RWD domain-containing protein 4 (RWDD4).	[6]

References

• [1] Mapping Complex Traits in a Diversity Outbred F1 Mouse Population Identifies Germline Modifiers of Metastasis in Human Prostate Cancer.Cell Syst. 2017 Jan 25;4(1):31-45.e6. doi: 10.1016/j.cels.2016.10.018. Epub 2016 Dec 1.
• [2] MiR-506 inhibits cell proliferation, invasion, migration and epithelial-to-mesenchymal transition through targeting RWDD4 in human bladder cancer.Oncol Lett. 2019 Jan;17(1):73-78. doi: 10.3892/ol.2018.9594. Epub 2018 Oct 18.
• [3] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [4] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [5] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [6] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.