Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTI8X03A)

• DOT Name: GTP-binding protein 8 (GTPBP8)
• Gene Name: GTPBP8
• UniProt ID: GTPB8_HUMAN
• Pfam ID: PF01926
• Sequence:
  MAAPGLRLGAGRLFEMPAVLERLSRYNSTSQAFAEVLRLPKQQLRKLLYPLQEVERFLAP
  YGRQDLHLRIFDPSPEDIARADNIFTATERNRIDYVSSAVRIDHAPDLPRPEVCFIGRSN
  VGKSSLIKALFSLAPEVEVRVSKKPGHTKKMNFFKVGKHFTVVDMPGYGFRAPEDFVDMV
  ETYLKERRNLKRTFLLVDSVVGIQKTDNIAIEMCEEFALPYVIVLTKIDKSSKGHLLKQV
  LQIQKFVNMKTQGCFPQLFPVSAVTFSGIHLLRCFIASVTGSLD

Molecular Interaction Atlas (MIA) of This DOT

12 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of GTP-binding protein 8 (GTPBP8).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of GTP-binding protein 8 (GTPBP8).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of GTP-binding protein 8 (GTPBP8).	[3]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of GTP-binding protein 8 (GTPBP8).	[4]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of GTP-binding protein 8 (GTPBP8).	[5]
Selenium	DM25CGV	Approved	Selenium decreases the expression of GTP-binding protein 8 (GTPBP8).	[6]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of GTP-binding protein 8 (GTPBP8).	[7]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol decreases the expression of GTP-binding protein 8 (GTPBP8).	[8]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of GTP-binding protein 8 (GTPBP8).	[9]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of GTP-binding protein 8 (GTPBP8).	[6]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of GTP-binding protein 8 (GTPBP8).	[7]
Deguelin	DMXT7WG	Investigative	Deguelin increases the expression of GTP-binding protein 8 (GTPBP8).	[11]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of GTP-binding protein 8 (GTPBP8).	[10]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [4] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [5] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [6] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [7] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [8] Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
• [9] Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
• [10] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [11] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.