Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTIY35CP)

DOT Name	Protein FAM78B (FAM78B)
Gene Name	FAM78B
Related Disease	Chronic kidney disease ( ) High blood pressure ( ) Non-insulin dependent diabetes ( )
UniProt ID	FA78B_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MGCIQSITCKARIRRENIVVYDVCATIDQCPTRIEETSPIVLRYKTPYFKASARVVMPPI PRHETWVVGWIQACNQMEFFNTYSDLGMSSWELPDLREGRVKAISDSDGVSYPWYGNTTE TVTLVGPTNKISRFSVSMNDNFYPSVTWAVPVSDSNVPLLTRIKRDQSFTTWLVAMNTTT KEKIILQTIKWRMRVDIEVDPLQLLGQRARLVGRTQQEQPRILSRMEPIPPNALVKPNAN DAQVLMWRPKRGPPLVVIPPK

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Chronic kidney disease	DISW82R7	Definitive	Biomarker	[1]
High blood pressure	DISY2OHH	moderate	Genetic Variation	[2]
Non-insulin dependent diabetes	DISK1O5Z	Limited	Altered Expression	[3]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Protein FAM78B (FAM78B).	[4]
------------------------------------------------------------------------------------

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Protein FAM78B (FAM78B).	[5]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Protein FAM78B (FAM78B).	[6]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Protein FAM78B (FAM78B).	[7]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Protein FAM78B (FAM78B).	[8]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Protein FAM78B (FAM78B).	[9]
------------------------------------------------------------------------------------

References

1	Identification of chromosome 3q28 and ALPK1 as susceptibility loci for chronic kidney disease in Japanese individuals by a genome-wide association study.J Med Genet. 2013 Jun;50(6):410-8. doi: 10.1136/jmedgenet-2013-101518. Epub 2013 Mar 28.
2	Association of genetic variants with hypertension in a longitudinal population-based genetic epidemiological study.Int J Mol Med. 2015 May;35(5):1189-98. doi: 10.3892/ijmm.2015.2151. Epub 2015 Mar 20.
3	Joint ancestry and association testing in admixed individuals.PLoS Comput Biol. 2011 Dec;7(12):e1002325. doi: 10.1371/journal.pcbi.1002325. Epub 2011 Dec 22.
4	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
5	Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
6	Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
7	The thioxotriazole copper(II) complex A0 induces endoplasmic reticulum stress and paraptotic death in human cancer cells. J Biol Chem. 2009 Sep 4;284(36):24306-19.
8	Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
9	Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.