Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTK1X62Z)

• DOT Name: Protein FAM3A (FAM3A)
• Synonyms: Cytokine-like protein 2-19
• Gene Name: FAM3A
• Related Disease:
  Hyperglycemia
  Non-alcoholic fatty liver disease
  Non-insulin dependent diabetes
  Vascular disease
  Osteoarthritis
  Obesity
• UniProt ID: FAM3A_HUMAN
• Pfam ID: PF15711
• Sequence:
  MRLAGPLRIVVLVVSVGVTWIVVSILLGGPGSGFPRIQQLFTSPESSVTAAPRARKYKCG
  LPQPCPEEHLAFRVVSGAANVIGPKICLEDKMLMSSVKDNVGRGLNIALVNGVSGELIEA
  RAFDMWAGDVNDLLKFIRPLHEGTLVFVASYDDPATKMNEETRKLFSELGSRNAKELAFR
  DSWVFVGAKGVQNKSPFEQHVKNSKHSNKYEGWPEALEMEGCIPRRSTAS
• Function: May act as a defensin against invading fungal microorganisms.
• Tissue Specificity: In similar amounts in testis, pancreas, adrenal, placenta, brain, fetal brain, liver, kidney, skeletal muscle and heart.

Molecular Interaction Atlas (MIA) of This DOT

6 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Hyperglycemia	DIS0BZB5	Definitive	Biomarker	[1]
Non-alcoholic fatty liver disease	DISDG1NL	Definitive	Altered Expression	[1]
Non-insulin dependent diabetes	DISK1O5Z	Definitive	Biomarker	[1]
Vascular disease	DISVS67S	Strong	Biomarker	[2]
Osteoarthritis	DIS05URM	moderate	Biomarker	[3]
Obesity	DIS47Y1K	Disputed	Biomarker	[4]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Protein FAM3A (FAM3A).	[5]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Protein FAM3A (FAM3A).	[7]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Selenium	DM25CGV	Approved	Selenium increases the expression of Protein FAM3A (FAM3A).	[6]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Protein FAM3A (FAM3A).	[8]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Protein FAM3A (FAM3A).	[9]

References

• [1] FAM3 gene family: A promising therapeutical target for NAFLD and type 2 diabetes.Metabolism. 2018 Apr;81:71-82. doi: 10.1016/j.metabol.2017.12.001. Epub 2017 Dec 6.
• [2] Endothelial FAM3A positively regulates post-ischaemic angiogenesis.EBioMedicine. 2019 May;43:32-42. doi: 10.1016/j.ebiom.2019.03.038. Epub 2019 Apr 16.
• [3] FAM3A protects chondrocytes against interleukin-1-induced apoptosis through regulating PI3K/Akt/mTOR pathway.Biochem Biophys Res Commun. 2019 Aug 13;516(1):209-214. doi: 10.1016/j.bbrc.2019.06.016. Epub 2019 Jun 14.
• [4] NFE2 Induces miR-423-5p to Promote Gluconeogenesis and Hyperglycemia by Repressing the Hepatic FAM3A-ATP-Akt Pathway.Diabetes. 2017 Jul;66(7):1819-1832. doi: 10.2337/db16-1172. Epub 2017 Apr 14.
• [5] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [6] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [7] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [8] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [9] Isobaric tags for relative and absolute quantitation-based proteomics analysis of the effect of ginger oil on bisphenol A-induced breast cancer cell proliferation. Oncol Lett. 2021 Feb;21(2):101. doi: 10.3892/ol.2020.12362. Epub 2020 Dec 8.