Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTK5YA5E)

DOT Name Ankyrin repeat and BTB/POZ domain-containing protein 2 (ABTB2)
Gene Name ABTB2
Related Disease
Acute myelogenous leukaemia ( )
UniProt ID
ABTB2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00023 ; PF12796 ; PF00651
Sequence
MAGTYSSTLKTLEDLTLDSGYGAGDSCRSLSLSSSKSNSQALNSSAQQHRGAAWWCYSGS
MNSRHNSWDTVNTVLPEDPEVADLFSRCPRLPELEEFPWTEGDVARVLRKGAGGRRLPQF
SAEAVRRLAGLLRRALIRVAREAQRLSVLHAKCTRFEVQSAVRLVHSWALAESCALAAVK
ALSLYSMSAGDGLRRGKSARCGLTFSVGRFFRWMVDTRISVRIHEYAAISLTACMENLVE
EIRARVMASHSPDGGGAGGGEVSAEALEMVINNDAELWGVLQPYEHLICGKNANGVLSLP
AYFSPYNGGSLGHDERADAYAQLELRTLEQSLLATCVGSISELSDLVSRAMHHMQGRHPL
CPGASPARQARQPPQPITWSPDALHTLYYFLRCPQMESMENPNLDPPRMTLNNERPFMLL
PPLMEWMRVAITYAEHRRSLTVDSGDIRQAARLLLPGLDCEPRQLKPEHCFSSFRRLDAR
AATEKFNQDLGFRMLNCGRTDLINQAIEALGPDGVNTMDDQGMTPLMYACAAGDEAMVQM
LIDAGANLDIQVPSNSPRHPSIHPDSRHWTSLTFAVLHGHISVVQLLLDAGAHVEGSAVN
GGEDSYAETPLQLASAAGNYELVSLLLSRGADPLLSMLEAHGMGSSLHEDMNCFSHSAAH
GHRNVLRKLLTQPQQAKADVLSLEEILAEGVEESDASSQGSGSEGPVRLSRTRTKALQEA
MYYSAEHGYVDITMELRALGVPWKLHIWIESLRTSFSQSRYSVVQSLLRDFSSIREEEYN
EELVTEGLQLMFDILKTSKNDSVIQQLATIFTHCYGSSPIPSIPEIRKTLPARLDPHFLN
NKEMSDVTFLVEGKLFYAHKVLLVTASNRFKTLMTNKSEQDGDSSKTIEISDMKYHIFQM
MMQYLYYGGTESMEIPTTDILELLSAASLFQLDALQRHCEILCSQTLSMESAVNTYKYAK
IHNAPELALFCEGFFLKHMKALLEQDAFRQLIYGRSSKVQGLDPLQDLQNTLAERVHSVY
ITSRV
Function May be involved in the initiation of hepatocyte growth.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Acute myelogenous leukaemia DISCSPTN moderate Genetic Variation [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Ankyrin repeat and BTB/POZ domain-containing protein 2 (ABTB2). [2]
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of Ankyrin repeat and BTB/POZ domain-containing protein 2 (ABTB2). [9]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 increases the phosphorylation of Ankyrin repeat and BTB/POZ domain-containing protein 2 (ABTB2). [17]
------------------------------------------------------------------------------------
14 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Ankyrin repeat and BTB/POZ domain-containing protein 2 (ABTB2). [3]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Ankyrin repeat and BTB/POZ domain-containing protein 2 (ABTB2). [4]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Ankyrin repeat and BTB/POZ domain-containing protein 2 (ABTB2). [5]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Ankyrin repeat and BTB/POZ domain-containing protein 2 (ABTB2). [6]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Ankyrin repeat and BTB/POZ domain-containing protein 2 (ABTB2). [7]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Ankyrin repeat and BTB/POZ domain-containing protein 2 (ABTB2). [8]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of Ankyrin repeat and BTB/POZ domain-containing protein 2 (ABTB2). [10]
Triclosan DMZUR4N Approved Triclosan decreases the expression of Ankyrin repeat and BTB/POZ domain-containing protein 2 (ABTB2). [11]
Phenobarbital DMXZOCG Approved Phenobarbital affects the expression of Ankyrin repeat and BTB/POZ domain-containing protein 2 (ABTB2). [12]
Demecolcine DMCZQGK Approved Demecolcine increases the expression of Ankyrin repeat and BTB/POZ domain-containing protein 2 (ABTB2). [13]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Ankyrin repeat and BTB/POZ domain-containing protein 2 (ABTB2). [14]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Ankyrin repeat and BTB/POZ domain-containing protein 2 (ABTB2). [15]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 increases the expression of Ankyrin repeat and BTB/POZ domain-containing protein 2 (ABTB2). [16]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of Ankyrin repeat and BTB/POZ domain-containing protein 2 (ABTB2). [13]
------------------------------------------------------------------------------------
⏷ Show the Full List of 14 Drug(s)

References

1 Genome-wide haplotype association study identify the FGFR2 gene as a risk gene for acute myeloid leukemia.Oncotarget. 2017 Jan 31;8(5):7891-7899. doi: 10.18632/oncotarget.13631.
2 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
4 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
5 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
6 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
7 The thioxotriazole copper(II) complex A0 induces endoplasmic reticulum stress and paraptotic death in human cancer cells. J Biol Chem. 2009 Sep 4;284(36):24306-19.
8 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
9 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
10 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
11 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
12 Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
13 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
14 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
15 New insights into BaP-induced toxicity: role of major metabolites in transcriptomics and contribution to hepatocarcinogenesis. Arch Toxicol. 2016 Jun;90(6):1449-58.
16 Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
17 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.