Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTKDCVC6)

DOT Name Phosphatidylethanolamine-binding protein 4 (PEBP4)
Synonyms PEBP-4; hPEBP4; Protein cousin-of-RKIP 1
Gene Name PEBP4
Related Disease
B-cell neoplasm ( )
Colorectal carcinoma ( )
Ovarian neoplasm ( )
Advanced cancer ( )
Glioma ( )
IgA nephropathy ( )
Lung adenocarcinoma ( )
Lung neoplasm ( )
Gastric cancer ( )
Neoplasm ( )
Stomach cancer ( )
Non-small-cell lung cancer ( )
Prostate cancer ( )
Prostate carcinoma ( )
Breast cancer ( )
Breast carcinoma ( )
Deafness dystonia syndrome ( )
Lung cancer ( )
Lung carcinoma ( )
Neoplasm of esophagus ( )
UniProt ID
PEBP4_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF01161
Sequence
MGWTMRLVTAALLLGLMMVVTGDEDENSPCAHEALLDEDTLFCQGLEVFYPELGNIGCKV
VPDCNNYRQKITSWMEPIVKFPGAVDGATYILVMVDPDAPSRAEPRQRFWRHWLVTDIKG
ADLKKGKIQGQELSAYQAPSPPAHSGFHRYQFFVYLQEGKVISLLPKENKTRGSWKMDRF
LNRFHLGEPEASTQFMTQNYQDSPTLQAPRERASEPKHKNQAEIAAC
Function Promotes AKT phosphorylation, suggesting a possible role in the PI3K-AKT signaling pathway.

Molecular Interaction Atlas (MIA) of This DOT

20 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
B-cell neoplasm DISVY326 Definitive Biomarker [1]
Colorectal carcinoma DIS5PYL0 Definitive Altered Expression [2]
Ovarian neoplasm DISEAFTY Definitive Biomarker [3]
Advanced cancer DISAT1Z9 Strong Altered Expression [4]
Glioma DIS5RPEH Strong Biomarker [4]
IgA nephropathy DISZ8MTK Strong Biomarker [5]
Lung adenocarcinoma DISD51WR Strong Altered Expression [6]
Lung neoplasm DISVARNB Strong Biomarker [7]
Gastric cancer DISXGOUK moderate Biomarker [8]
Neoplasm DISZKGEW moderate Altered Expression [4]
Stomach cancer DISKIJSX moderate Biomarker [8]
Non-small-cell lung cancer DIS5Y6R9 Disputed Biomarker [7]
Prostate cancer DISF190Y Disputed Biomarker [9]
Prostate carcinoma DISMJPLE Disputed Biomarker [9]
Breast cancer DIS7DPX1 Limited Biomarker [10]
Breast carcinoma DIS2UE88 Limited Biomarker [10]
Deafness dystonia syndrome DIS0480U Limited Altered Expression [11]
Lung cancer DISCM4YA Limited Biomarker [11]
Lung carcinoma DISTR26C Limited Biomarker [11]
Neoplasm of esophagus DISOLKAQ Limited Genetic Variation [12]
------------------------------------------------------------------------------------
⏷ Show the Full List of 20 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
6 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Phosphatidylethanolamine-binding protein 4 (PEBP4). [13]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Phosphatidylethanolamine-binding protein 4 (PEBP4). [14]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Phosphatidylethanolamine-binding protein 4 (PEBP4). [15]
Testosterone DM7HUNW Approved Testosterone increases the expression of Phosphatidylethanolamine-binding protein 4 (PEBP4). [15]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the mutagenesis of Phosphatidylethanolamine-binding protein 4 (PEBP4). [16]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Phosphatidylethanolamine-binding protein 4 (PEBP4). [17]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Phosphatidylethanolamine-binding protein 4 (PEBP4). [18]
------------------------------------------------------------------------------------

References

1 Silencing of human phosphatidylethanolamine-binding protein 4 enhances rituximab-induced death and chemosensitization in B-cell lymphoma.PLoS One. 2013;8(2):e56829. doi: 10.1371/journal.pone.0056829. Epub 2013 Feb 25.
2 Expression of PEBP4 protein correlates with the invasion and metastasis of colorectal cancer.Tumour Biol. 2012 Feb;33(1):267-73. doi: 10.1007/s13277-011-0279-x. Epub 2011 Nov 29.
3 Anti-apoptotic hPEBP4 silencing promotes TRAIL-induced apoptosis of human ovarian cancer cells by activating ERK and JNK pathways.Int J Mol Med. 2006 Sep;18(3):505-10.
4 Knockdown of PEBP4 inhibits human glioma cell growth and invasive potential via ERK1/2 signaling pathway.Mol Carcinog. 2019 Jan;58(1):135-143. doi: 10.1002/mc.22915. Epub 2018 Oct 5.
5 Phosphatidylethanolamine binding protein-4 (PEBP4) is increased in IgA nephropathy and is associated with IgA-positive B-cells in affected kidneys.J Autoimmun. 2019 Dec;105:102309. doi: 10.1016/j.jaut.2019.102309. Epub 2019 Aug 9.
6 miR-15b regulates cisplatin resistance and metastasis by targeting PEBP4 in human lung adenocarcinoma cells.Cancer Gene Ther. 2015 Apr;22(3):108-14. doi: 10.1038/cgt.2014.73. Epub 2015 Feb 27.
7 Phosphatidylethanolamine-binding protein 4 promotes the epithelial-to-mesenchymal transition in non-small cell lung cancer cells by activating the sonic hedgehog signaling pathway.J Cell Biochem. 2019 Apr;120(4):5386-5395. doi: 10.1002/jcb.27817. Epub 2018 Oct 26.
8 Role of the PEBP4 protein in the development and metastasis of gastric cancer.Oncotarget. 2017 Mar 14;8(11):18177-18184. doi: 10.18632/oncotarget.15255.
9 PEBP4 silencing inhibits hypoxia-induced epithelial-to-mesenchymal transition in prostate cancer cells.Biomed Pharmacother. 2016 Jul;81:1-6. doi: 10.1016/j.biopha.2016.03.030. Epub 2016 Apr 6.
10 Knockdown of PEBP4 suppresses proliferation, migration and invasion of human breast cancer cells.Biomed Pharmacother. 2017 Jun;90:659-664. doi: 10.1016/j.biopha.2017.03.098. Epub 2017 Apr 14.
11 Downregulation of PEBP4, a target of miR-34a, sensitizes drug-resistant lung cancer cells.Tumour Biol. 2014 Oct;35(10):10341-9. doi: 10.1007/s13277-014-2284-3. Epub 2014 Jul 21.
12 Genome-wide association analyses of esophageal squamous cell carcinoma in Chinese identify multiple susceptibility loci and gene-environment interactions.Nat Genet. 2012 Oct;44(10):1090-7. doi: 10.1038/ng.2411. Epub 2012 Sep 9.
13 Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
14 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
15 Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
16 Exome-wide mutation profile in benzo[a]pyrene-derived post-stasis and immortal human mammary epithelial cells. Mutat Res Genet Toxicol Environ Mutagen. 2014 Dec;775-776:48-54. doi: 10.1016/j.mrgentox.2014.10.011. Epub 2014 Nov 4.
17 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
18 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.