Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTKEQLNK)

• DOT Name: Coiled-coil domain-containing protein 85B (CCDC85B)
• Synonyms: Hepatitis delta antigen-interacting protein A; Delta-interacting protein A
• Gene Name: CCDC85B
• Related Disease:
  Lung cancer
  Lung carcinoma
  Non-small-cell lung cancer
• UniProt ID: CC85B_HUMAN
• Pfam ID: PF10226
• Sequence:
  MEAEAGGLEELTDEEMAALGKEELVRRLRREEAARLAALVQRGRLMQEVNRQLQGHLGEI
  RELKQLNRRLQAENRELRDLCCFLDSERQRGRRAARQWQLFGTQASRAVREDLGGCWQKL
  AELEGRQEELLRENLALKELCLALGEEWGPRGGPSGAGGSGAGPAPELALPPCGPRDLGD
  GSSSTGSVGSPDQLPLACSPDD
• Function: Functions as a transcriptional repressor. May inhibit the activity of CTNNB1 in a TP53-dependent manner and thus regulate cell growth. May function in adipocyte differentiation, negatively regulating mitotic clonal expansion. Plays a role in cell-cell adhesion and epithelium development through its interaction with proteins of the beta-catenin family; (Microbial infection) Plays a role in hepatitis delta virus (HDV) genomic replication.
• Tissue Specificity: Widely expressed including liver.

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Lung cancer	DISCM4YA	Strong	Biomarker	[1]
Lung carcinoma	DISTR26C	Strong	Biomarker	[1]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[1]

12 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Coiled-coil domain-containing protein 85B (CCDC85B).	[2]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Coiled-coil domain-containing protein 85B (CCDC85B).	[3]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Coiled-coil domain-containing protein 85B (CCDC85B).	[4]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Coiled-coil domain-containing protein 85B (CCDC85B).	[5]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Coiled-coil domain-containing protein 85B (CCDC85B).	[6]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol decreases the expression of Coiled-coil domain-containing protein 85B (CCDC85B).	[7]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of Coiled-coil domain-containing protein 85B (CCDC85B).	[8]
Piroxicam	DMTK234	Approved	Piroxicam increases the expression of Coiled-coil domain-containing protein 85B (CCDC85B).	[9]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Coiled-coil domain-containing protein 85B (CCDC85B).	[10]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Coiled-coil domain-containing protein 85B (CCDC85B).	[11]
UNC0379	DMD1E4J	Preclinical	UNC0379 decreases the expression of Coiled-coil domain-containing protein 85B (CCDC85B).	[12]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Coiled-coil domain-containing protein 85B (CCDC85B).	[13]

References

• [1] CCDC85B promotes non-small cell lung cancer cell proliferation and invasion.Mol Carcinog. 2019 Jan;58(1):126-134. doi: 10.1002/mc.22914. Epub 2018 Oct 9.
• [2] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [3] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [4] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [5] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [6] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [7] Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
• [8] Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
• [9] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [10] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [11] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [12] Epigenetic siRNA and chemical screens identify SETD8 inhibition as a therapeutic strategy for p53 activation in high-risk neuroblastoma. Cancer Cell. 2017 Jan 9;31(1):50-63.
• [13] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.