Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTKGZ89D)

• DOT Name: MAL-like protein (MALL)
• Synonyms: Protein BENE
• Gene Name: MALL
• Related Disease:
  Adenoma
  Colon cancer
  Colon carcinoma
  Neoplasm
  Nephronophthisis
  Neural tube defect
  Cervical cancer
• UniProt ID: MALL_HUMAN
• Pfam ID: PF01284
• Sequence:
  MASPDPPATSYAPSDVPSGVALFLTIPFAFFLPELIFGFLVWTMVAATHIVYPLLQGWVM
  YVSLTSFLISLMFLLSYLFGFYKRFESWRVLDSLYHGTTGILYMSAAVLQVHATIVSEKL
  LDPRIYYINSAASFFAFIATLLYILHAFSIYYH

Molecular Interaction Atlas (MIA) of This DOT

7 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adenoma	DIS78ZEV	Strong	Altered Expression	[1]
Colon cancer	DISVC52G	Strong	Altered Expression	[2]
Colon carcinoma	DISJYKUO	Strong	Altered Expression	[2]
Neoplasm	DISZKGEW	Strong	Genetic Variation	[3]
Nephronophthisis	DISXU4HY	Strong	Genetic Variation	[4]
Neural tube defect	DIS5J95E	Disputed	Biomarker	[5]
Cervical cancer	DISFSHPF	Limited	Altered Expression	[6]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic trioxide	DM61TA4	Approved	MAL-like protein (MALL) decreases the response to substance of Arsenic trioxide.	[19]

10 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of MAL-like protein (MALL).	[7]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of MAL-like protein (MALL).	[8]
Selenium	DM25CGV	Approved	Selenium increases the expression of MAL-like protein (MALL).	[9]
Folic acid	DMEMBJC	Approved	Folic acid affects the expression of MAL-like protein (MALL).	[10]
Irinotecan	DMP6SC2	Approved	Irinotecan increases the expression of MAL-like protein (MALL).	[11]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the expression of MAL-like protein (MALL).	[12]
Seocalcitol	DMKL9QO	Phase 3	Seocalcitol increases the expression of MAL-like protein (MALL).	[13]
Afimoxifene	DMFORDT	Phase 2	Afimoxifene decreases the expression of MAL-like protein (MALL).	[14]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of MAL-like protein (MALL).	[16]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of MAL-like protein (MALL).	[18]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of MAL-like protein (MALL).	[15]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of MAL-like protein (MALL).	[17]

References

• [1] Gene profiling of colonic serrated adenomas by using oligonucleotide microarray.Int J Colorectal Dis. 2008 Jun;23(6):569-80. doi: 10.1007/s00384-008-0451-y. Epub 2008 Feb 28.
• [2] Digital transcript profile analysis with aRNA-LongSAGE validates FERMT1 as a potential novel prognostic marker for colon cancer.Clin Cancer Res. 2011 May 1;17(9):2908-18. doi: 10.1158/1078-0432.CCR-10-2552. Epub 2011 Jan 10.
• [3] Extremely high genetic diversity in a single tumor points to prevalence of non-Darwinian cell evolution.Proc Natl Acad Sci U S A. 2015 Nov 24;112(47):E6496-505. doi: 10.1073/pnas.1519556112. Epub 2015 Nov 11.
• [4] Atypical retinopathy in patients with nephronophthisis type 1: an uncommon ophthalmological finding.Clin Exp Ophthalmol. 2015 Jul;43(5):437-42. doi: 10.1111/ceo.12469. Epub 2015 Jan 14.
• [5] Use of routinely collected amniotic fluid for whole-genome expression analysis of polygenic disorders.Clin Chem. 2006 Nov;52(11):2013-20. doi: 10.1373/clinchem.2006.074971. Epub 2006 Sep 28.
• [6] Down-regulation of members of glycolipid-enriched membrane raft gene family, MAL and BENE, in cervical squamous cell cancers.J Obstet Gynaecol Res. 2004 Feb;30(1):53-8. doi: 10.1111/j.1341-8076.2004.00156.x.
• [7] Long-term estrogen exposure promotes carcinogen bioactivation, induces persistent changes in gene expression, and enhances the tumorigenicity of MCF-7 human breast cancer cells. Toxicol Appl Pharmacol. 2009 Nov 1;240(3):355-66.
• [8] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [9] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [10] Folate deficiency in normal human fibroblasts leads to altered expression of genes primarily linked to cell signaling, the cytoskeleton and extracellular matrix. J Nutr Biochem. 2007 Aug;18(8):541-52. doi: 10.1016/j.jnutbio.2006.11.002. Epub 2007 Feb 22.
• [11] In vitro and in vivo irinotecan-induced changes in expression profiles of cell cycle and apoptosis-associated genes in acute myeloid leukemia cells. Mol Cancer Ther. 2005 Jun;4(6):885-900.
• [12] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [13] Expression profiling in squamous carcinoma cells reveals pleiotropic effects of vitamin D3 analog EB1089 signaling on cell proliferation, differentiation, and immune system regulation. Mol Endocrinol. 2002 Jun;16(6):1243-56.
• [14] Regulation of aryl hydrocarbon receptor function by selective estrogen receptor modulators. Mol Endocrinol. 2010 Jan;24(1):33-46.
• [15] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [16] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [17] Expression and DNA methylation changes in human breast epithelial cells after bisphenol A exposure. Int J Oncol. 2012 Jul;41(1):369-77.
• [18] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [19] The NRF2-mediated oxidative stress response pathway is associated with tumor cell resistance to arsenic trioxide across the NCI-60 panel. BMC Med Genomics. 2010 Aug 13;3:37. doi: 10.1186/1755-8794-3-37.