Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTL1QJSP)

DOT Name S1 RNA-binding domain-containing protein 1 (SRBD1)
Gene Name SRBD1
Related Disease
Glaucoma/ocular hypertension ( )
Non-insulin dependent diabetes ( )
OPTN-related open angle glaucoma ( )
Acute myelogenous leukaemia ( )
UniProt ID
SRBD1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF12836 ; PF17674 ; PF00575 ; PF09371 ; PF16921
Sequence
MSSLPRRAKVQVQDVVLKDEFSSFSELSSASEEDDKEDSAWEPQKKVPRSRKQPPPKESK
PKRMPRVKKNAPQISDGSEVVVVKEELNSSVAIADTALEDRKNKLDTVQTLKTAKTKQKC
AAQPHTVRRTKKLKVEEETSKASNLEGESNSSETPSTSTVWGGTCKKEENDDDFTFGQSA
LKKIKTETYPQGQPVKFPANANSTKEEVEMNWDMVQVLSERTNIEPWVCANIIRLFNDDN
TIPFIIRYRKELINNLDADSLREVQQTLEELRAVAKKVHSTIQKIKKEGKMSECLLKAML
NCKTFEELEHVSAPYKTGSKGTKAQRARQLGLEGAARALLEKPGELSLLSYIRPDVKGLS
TLQDIEIGVQHILADMIAKDKDTLDFIRNLCQKRHVCIQSSLAKVSSKKVNEKDVDKFLL
YQHFSCNIRNIHHHQILAINRGENLKVLTVKVNISDGVKDEFCRWCIQNRWRPRSFARPE
LMKILYNSLNDSFKRLIYPLLCREFRAKLTSDAEKESVMMFGRNLRQLLLTSPVPGRTLM
GVDPGYKHGCKLAIISPTSQILHTDVVYLHCGQGFREAEKIKTLLLNFNCSTVVIGNGTA
CRETEAYFADLIMKNYFAPLDVVYCIVSEAGASIYSVSPEANKEMPGLDPNLRSAVSIAR
RVQDPLAELVKIEPKHIGVGMYQHDVSQTLLKATLDSVVEECVSFVGVDINICSEVLLRH
IAGLNANRAKNIIEWREKNGPFINREQLKKVKGLGPKSFQQCAGFIRINQDYIRTFCSQQ
TETSGQIQGVAVTSSADVEVTNEKQGKKKSKTAVNVLLKPNPLDQTCIHPESYDIAMRFL
SSIGGTLYEVGKPEMQQKINSFLEKEGMEKIAERLQTTVHTLQVIIDGLSQPESFDFRTD
FDKPDFKRSIVCLEDLQIGTVLTGKVENATLFGIFVDIGVGKSGLIPIRNVTEAKLSKTK
KRRSLGLGPGERVEVQVLNIDIPRSRITLDLIRVL

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Glaucoma/ocular hypertension DISLBXBY Definitive Genetic Variation [1]
Non-insulin dependent diabetes DISK1O5Z Strong Genetic Variation [2]
OPTN-related open angle glaucoma DISDR98A Strong Genetic Variation [3]
Acute myelogenous leukaemia DISCSPTN Limited Genetic Variation [4]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
10 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate affects the expression of S1 RNA-binding domain-containing protein 1 (SRBD1). [5]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of S1 RNA-binding domain-containing protein 1 (SRBD1). [6]
Tretinoin DM49DUI Approved Tretinoin increases the expression of S1 RNA-binding domain-containing protein 1 (SRBD1). [7]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of S1 RNA-binding domain-containing protein 1 (SRBD1). [8]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of S1 RNA-binding domain-containing protein 1 (SRBD1). [9]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of S1 RNA-binding domain-containing protein 1 (SRBD1). [10]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of S1 RNA-binding domain-containing protein 1 (SRBD1). [11]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of S1 RNA-binding domain-containing protein 1 (SRBD1). [12]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of S1 RNA-binding domain-containing protein 1 (SRBD1). [13]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of S1 RNA-binding domain-containing protein 1 (SRBD1). [15]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Drug(s)
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
TAK-243 DM4GKV2 Phase 1 TAK-243 increases the sumoylation of S1 RNA-binding domain-containing protein 1 (SRBD1). [14]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 affects the phosphorylation of S1 RNA-binding domain-containing protein 1 (SRBD1). [16]
------------------------------------------------------------------------------------

References

1 Dogs and humans share a common susceptibility gene SRBD1 for glaucoma risk.PLoS One. 2013 Sep 11;8(9):e74372. doi: 10.1371/journal.pone.0074372. eCollection 2013.
2 First genome-wide association study in an Australian aboriginal population provides insights into genetic risk factors for body mass index and type 2 diabetes.PLoS One. 2015 Mar 11;10(3):e0119333. doi: 10.1371/journal.pone.0119333. eCollection 2015.
3 Involvement of genetic variants associated with primary open-angle glaucoma in pathogenic mechanisms and family history of glaucoma.Am J Ophthalmol. 2015 Mar;159(3):437-44.e2. doi: 10.1016/j.ajo.2014.11.023. Epub 2014 Nov 18.
4 Genome-wide haplotype association study identify the FGFR2 gene as a risk gene for acute myeloid leukemia.Oncotarget. 2017 Jan 31;8(5):7891-7899. doi: 10.18632/oncotarget.13631.
5 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
6 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
7 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
8 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
9 The thioxotriazole copper(II) complex A0 induces endoplasmic reticulum stress and paraptotic death in human cancer cells. J Biol Chem. 2009 Sep 4;284(36):24306-19.
10 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
11 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
12 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
13 Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
14 Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
15 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
16 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.