Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTMD7O88)

• DOT Name: Uncharacterized protein C1orf21 (C1ORF21)
• Synonyms: Cell proliferation-inducing gene 13 protein
• Gene Name: C1ORF21
• Related Disease:
  Cardiac failure
  Colorectal carcinoma
• UniProt ID: CA021_HUMAN
• Pfam ID: PF15389
• Sequence:
  MGCASAKHVATVQNEEEAQKGKNYQNGDVFGDEYRIKPVEEVKYMKNGAEEEQKIAARNQ
  ENLEKSASSNVRLKTNKEVPGLVHQPRANMHISESQQEFFRMLDEKIEKGRDYCSEEEDI
  T
• Tissue Specificity: Expressed in spleen, prostate, testis and uterus.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Cardiac failure	DISDC067	Strong	Genetic Variation	[1]
Colorectal carcinoma	DIS5PYL0	Strong	Genetic Variation	[2]

14 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Uncharacterized protein C1orf21 (C1ORF21).	[3]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Uncharacterized protein C1orf21 (C1ORF21).	[4]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Uncharacterized protein C1orf21 (C1ORF21).	[5]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Uncharacterized protein C1orf21 (C1ORF21).	[6]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Uncharacterized protein C1orf21 (C1ORF21).	[7]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Uncharacterized protein C1orf21 (C1ORF21).	[8]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Uncharacterized protein C1orf21 (C1ORF21).	[9]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Uncharacterized protein C1orf21 (C1ORF21).	[8]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Uncharacterized protein C1orf21 (C1ORF21).	[10]
Isotretinoin	DM4QTBN	Approved	Isotretinoin increases the expression of Uncharacterized protein C1orf21 (C1ORF21).	[11]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Uncharacterized protein C1orf21 (C1ORF21).	[12]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Uncharacterized protein C1orf21 (C1ORF21).	[13]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Uncharacterized protein C1orf21 (C1ORF21).	[14]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Uncharacterized protein C1orf21 (C1ORF21).	[15]

References

• [1] Genetics of heart rate in heart failure patients (GenHRate).Hum Genomics. 2019 May 21;13(1):22. doi: 10.1186/s40246-019-0206-6.
• [2] Genome-wide association study for colorectal cancer identifies risk polymorphisms in German familial cases and implicates MAPK signalling pathways in disease susceptibility.Carcinogenesis. 2010 Sep;31(9):1612-9. doi: 10.1093/carcin/bgq146. Epub 2010 Jul 7.
• [3] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [4] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [5] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [6] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [7] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [8] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [9] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [10] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [11] Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
• [12] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [13] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [14] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [15] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.