Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTMXLD6F)

• DOT Name: Eukaryotic translation initiation factor 1b (EIF1B)
• Synonyms: eIF1b; Protein translation factor SUI1 homolog GC20
• Gene Name: EIF1B
• UniProt ID: EIF1B_HUMAN
• Pfam ID: PF01253
• Sequence:
  MSTIQNLQSFDPFADATKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLV
  KAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF
• Function: Probably involved in translation.

Molecular Interaction Atlas (MIA) of This DOT

12 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Eukaryotic translation initiation factor 1b (EIF1B).	[1]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Eukaryotic translation initiation factor 1b (EIF1B).	[2]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Eukaryotic translation initiation factor 1b (EIF1B).	[3]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Eukaryotic translation initiation factor 1b (EIF1B).	[4]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Eukaryotic translation initiation factor 1b (EIF1B).	[5]
Selenium	DM25CGV	Approved	Selenium decreases the expression of Eukaryotic translation initiation factor 1b (EIF1B).	[6]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Eukaryotic translation initiation factor 1b (EIF1B).	[7]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Eukaryotic translation initiation factor 1b (EIF1B).	[8]
APR-246	DMNFADH	Phase 2	APR-246 affects the expression of Eukaryotic translation initiation factor 1b (EIF1B).	[9]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the expression of Eukaryotic translation initiation factor 1b (EIF1B).	[12]
Milchsaure	DM462BT	Investigative	Milchsaure affects the expression of Eukaryotic translation initiation factor 1b (EIF1B).	[13]
chloropicrin	DMSGBQA	Investigative	chloropicrin affects the expression of Eukaryotic translation initiation factor 1b (EIF1B).	[14]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Eukaryotic translation initiation factor 1b (EIF1B).	[10]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Eukaryotic translation initiation factor 1b (EIF1B).	[11]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Pharmacogenomic analysis of acute promyelocytic leukemia cells highlights CYP26 cytochrome metabolism in differential all-trans retinoic acid sensitivity. Blood. 2007 May 15;109(10):4450-60.
• [3] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [4] The thioxotriazole copper(II) complex A0 induces endoplasmic reticulum stress and paraptotic death in human cancer cells. J Biol Chem. 2009 Sep 4;284(36):24306-19.
• [5] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [6] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [7] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [8] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [9] Mutant p53 reactivation by PRIMA-1MET induces multiple signaling pathways converging on apoptosis. Oncogene. 2010 Mar 4;29(9):1329-38. doi: 10.1038/onc.2009.425. Epub 2009 Nov 30.
• [10] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [11] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [12] Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
• [13] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [14] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.