Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTN1HRBN)

DOT Name	Protein phosphatase 1 regulatory subunit 42 (PPP1R42)
Synonyms	Leucine-rich repeat-containing protein 67
Gene Name	PPP1R42
Related Disease	Alzheimer disease ( ) Aortic aneurysm ( ) Diphtheria ( ) Inflammatory bowel disease ( ) Myocardial infarction ( ) Scrub typhus ( ) Stroke ( ) Graft-versus-host disease ( )
UniProt ID	PPR42_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF12799 ; PF14580
Sequence	MVRLTLDLIARNSNLKPRKEETISQCLKKITHINFSDKNIDAIEDLSLCKNLSVLYLYDN CISQITNLNYATNLTHLYLQNNCISCIENLRSLKKLEKLYLGGNYIAVIEGLEGLGELRE LHVENQRLPLGEKLLFDPRTLHSLAKSLCILNISNNNIDDITDLELLENLNQLIAVDNQL LHVKDLEFLLNKLMKLWKIDLNGNPVCLKPKYRDRLILVSKSLEFLDGKEIKNIERQFLM NWKASKDAKKISKKRSSKNEDASNSLISNFKTMHHIVPVYYPQVGKPKLAFFSEIQRYPV NANASPESS
Function	Regulates phosphatase activity of protein phosphatase 1 (PP1) complexes in the testis.

Molecular Interaction Atlas (MIA) of This DOT

8 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Alzheimer disease	DISF8S70	Strong	Genetic Variation	[1]
Aortic aneurysm	DISQ5KRA	Strong	Biomarker	[2]
Diphtheria	DISZWM55	Strong	Biomarker	[3]
Inflammatory bowel disease	DISGN23E	Strong	Biomarker	[4]
Myocardial infarction	DIS655KI	Strong	Biomarker	[5]
Scrub typhus	DISRXONX	Strong	Biomarker	[6]
Stroke	DISX6UHX	Strong	Genetic Variation	[2]
Graft-versus-host disease	DIS0QADF	moderate	Biomarker	[7]
------------------------------------------------------------------------------------


⏷ Show the Full List of 8 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Protein phosphatase 1 regulatory subunit 42 (PPP1R42) increases the response to substance of Cisplatin.	[8]
------------------------------------------------------------------------------------

References

1	Family-based association analyses of imputed genotypes reveal genome-wide significant association of Alzheimer's disease with OSBPL6, PTPRG, and PDCL3.Mol Psychiatry. 2016 Nov;21(11):1608-1612. doi: 10.1038/mp.2015.218. Epub 2016 Feb 2.
2	Clinical outcomes of different surgical approaches for proximal descending thoracic aneurysm involving the distal arch.J Thorac Cardiovasc Surg. 2018 Jun;155(6):2289-2298.e1. doi: 10.1016/j.jtcvs.2017.12.152. Epub 2018 Feb 20.
3	Tissue Resident CCR2- and CCR2+ Cardiac Macrophages Differentially Orchestrate Monocyte Recruitment and Fate Specification Following Myocardial Injury.Circ Res. 2019 Jan 18;124(2):263-278. doi: 10.1161/CIRCRESAHA.118.314028.
4	hucMSCs Attenuate IBD through Releasing miR148b-5p to Inhibit the Expression of 15-lox-1 in Macrophages.Mediators Inflamm. 2019 May 28;2019:6953963. doi: 10.1155/2019/6953963. eCollection 2019.
5	Differential contribution of monocytes to heart macrophages in steady-state and after myocardial infarction.Circ Res. 2014 Jul 7;115(2):284-95. doi: 10.1161/CIRCRESAHA.115.303567. Epub 2014 May 1.
6	Climate variability, animal reservoir and transmission of scrub typhus in Southern China.PLoS Negl Trop Dis. 2017 Mar 8;11(3):e0005447. doi: 10.1371/journal.pntd.0005447. eCollection 2017 Mar.
7	Azacitidine Mitigates Graft-versus-Host Disease via Differential Effects on the Proliferation of T Effectors and Natural Regulatory T Cells In Vivo.J Immunol. 2017 May 1;198(9):3746-3754. doi: 10.4049/jimmunol.1502399. Epub 2017 Mar 22.
8	Genome-wide local ancestry approach identifies genes and variants associated with chemotherapeutic susceptibility in African Americans. PLoS One. 2011;6(7):e21920. doi: 10.1371/journal.pone.0021920. Epub 2011 Jul 6.