Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTNFHROL)

• DOT Name: Leucine-rich repeat-containing protein 73 (LRRC73)
• Gene Name: LRRC73
• UniProt ID: LRC73_HUMAN
• Sequence:
  MLPSSIQISGEPLSGAEVRDICRGLRDNAVRLLSLRGCRLCDRDFGRICRALAGATSLAQ
  LNLNLGVVSSPSRIKQLAEALRTNRSIQSLFLHGSPLTDAGLALLNPALALHPALVALDL
  GDCMLGDEAINLICGLLPPDGAKSGLKELTLSANPGITPKGWSRLAIAVAHSSQVRVLNL
  DYNPLGDHVAGMLAVAVASSRTLEVLDLEGTGLTNQSAQTLLDMVENYPTALRSLVLAEN
  SISPELQQQICDLLSEGEEEEEVAGGAGDTQEWERGREPAAHQRGSSSWMCPSDPSSQMV
  LMTSGLGDSLLAETEM

Molecular Interaction Atlas (MIA) of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Leucine-rich repeat-containing protein 73 (LRRC73).	[1]

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Leucine-rich repeat-containing protein 73 (LRRC73).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Leucine-rich repeat-containing protein 73 (LRRC73).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Leucine-rich repeat-containing protein 73 (LRRC73).	[4]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Leucine-rich repeat-containing protein 73 (LRRC73).	[5]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Leucine-rich repeat-containing protein 73 (LRRC73).	[6]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Leucine-rich repeat-containing protein 73 (LRRC73).	[7]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Leucine-rich repeat-containing protein 73 (LRRC73).	[8]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Leucine-rich repeat-containing protein 73 (LRRC73).	[9]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Leucine-rich repeat-containing protein 73 (LRRC73).	[10]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [4] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [5] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [6] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [7] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [8] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [9] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [10] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.