Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTOP9Q1V)

• DOT Name: Putative RNA-binding protein Luc7-like 2 (LUC7L2)
• Gene Name: LUC7L2
• Related Disease:
  Myelodysplastic syndrome
  Asthma
• UniProt ID: LC7L2_HUMAN
• Pfam ID: PF03194
• Sequence:
  MSAQAQMRAMLDQLMGTSRDGDTTRQRIKFSDDRVCKSHLLNCCPHDVLSGTRMDLGECL
  KVHDLALRADYEIASKEQDFFFELDAMDHLQSFIADCDRRTEVAKKRLAETQEEISAEVA
  AKAERVHELNEEIGKLLAKVEQLGAEGNVEESQKVMDEVEKARAKKREAEEVYRNSMPAS
  SFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIEIREKLEELKRVVAEKQEKRN
  QERLKRREEREREEREKLRRSRSHSKNPKRSRSREHRRHRSRSMSRERKRRTRSKSREKR
  HRHRSRSSSRSRSRSHQRSRHSSRDRSRERSKRRSSKERFRDQDLASCDRDRSSRDRSPR
  DRDRKDKKRSYESANGRSEDRRSSEEREAGEI
• Function: May bind to RNA via its Arg/Ser-rich domain.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Myelodysplastic syndrome	DISYHNUI	Strong	Genetic Variation	[1]
Asthma	DISW9QNS	moderate	Genetic Variation	[2]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Putative RNA-binding protein Luc7-like 2 (LUC7L2).	[3]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Putative RNA-binding protein Luc7-like 2 (LUC7L2).	[8]
Coumarin	DM0N8ZM	Investigative	Coumarin increases the phosphorylation of Putative RNA-binding protein Luc7-like 2 (LUC7L2).	[8]

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Putative RNA-binding protein Luc7-like 2 (LUC7L2).	[4]
Arsenic	DMTL2Y1	Approved	Arsenic decreases the expression of Putative RNA-binding protein Luc7-like 2 (LUC7L2).	[5]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Putative RNA-binding protein Luc7-like 2 (LUC7L2).	[6]
Selenium	DM25CGV	Approved	Selenium decreases the expression of Putative RNA-binding protein Luc7-like 2 (LUC7L2).	[7]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of Putative RNA-binding protein Luc7-like 2 (LUC7L2).	[7]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Putative RNA-binding protein Luc7-like 2 (LUC7L2).	[9]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Putative RNA-binding protein Luc7-like 2 (LUC7L2).	[10]

References

• [1] Distinct and convergent consequences of splice factor mutations in myelodysplastic syndromes.Am J Hematol. 2020 Feb;95(2):133-143. doi: 10.1002/ajh.25673. Epub 2019 Nov 18.
• [2] Genome-Wide Association Study Identifies Novel Loci Associated With Diisocyanate-Induced Occupational Asthma.Toxicol Sci. 2015 Jul;146(1):192-201. doi: 10.1093/toxsci/kfv084. Epub 2015 Apr 26.
• [3] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [4] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [5] Arsenic alters transcriptional responses to Pseudomonas aeruginosa infection and decreases antimicrobial defense of human airway epithelial cells. Toxicol Appl Pharmacol. 2017 Sep 15;331:154-163.
• [6] A genomic approach to predict synergistic combinations for breast cancer treatment. Pharmacogenomics J. 2013 Feb;13(1):94-104. doi: 10.1038/tpj.2011.48. Epub 2011 Nov 15.
• [7] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [8] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [9] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [10] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.