Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTP5URZ8)

• DOT Name: ETS translocation variant 2 (ETV2)
• Synonyms: Ets-related protein 71
• Gene Name: ETV2
• Related Disease:
  Neoplasm
  Adult glioblastoma
  Glioblastoma multiforme
  Prostate cancer
  Prostate carcinoma
  Prostate neoplasm
  Cardiovascular disease
  Myocardial infarction
• UniProt ID: ETV2_HUMAN
• Pfam ID: PF00178
• Sequence:
  MDLWNWDEASPQEVPPGNKLAGLEGAKLGFCFPDLALQGDTPTATAETCWKGTSSSLASF
  PQLDWGSALLHPEVPWGAEPDSQALPWSGDWTDMACTAWDSWSGASQTLGPAPLGPGPIP
  AAGSEGAAGQNCVPVAGEATSWSRAQAAGSNTSWDCSVGPDGDTYWGSGLGGEPRTDCTI
  SWGGPAGPDCTTSWNPGLHAGGTTSLKRYQSSALTVCSEPSPQSDRASLARCPKTNHRGP
  IQLWQFLLELLHDGARSSCIRWTGNSREFQLCDPKEVARLWGERKRKPGMNYEKLSRGLR
  YYYRRDIVRKSGGRKYTYRFGGRVPSLAYPDCAGGGRGAETQ
• Function: Binds to DNA sequences containing the consensus pentanucleotide 5'-CGGA[AT]-3'.

Molecular Interaction Atlas (MIA) of This DOT

8 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Neoplasm	DISZKGEW	Definitive	Altered Expression	[1]
Adult glioblastoma	DISVP4LU	Strong	Biomarker	[2]
Glioblastoma multiforme	DISK8246	Strong	Biomarker	[2]
Prostate cancer	DISF190Y	Strong	Biomarker	[3]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[3]
Prostate neoplasm	DISHDKGQ	Strong	Altered Expression	[3]
Cardiovascular disease	DIS2IQDX	Limited	Biomarker	[4]
Myocardial infarction	DIS655KI	Limited	Biomarker	[5]

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of ETS translocation variant 2 (ETV2).	[6]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of ETS translocation variant 2 (ETV2).	[8]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of ETS translocation variant 2 (ETV2).	[7]

References

• [1] Requisite endothelial reactivation and effective siRNA nanoparticle targeting of Etv2/Er71 in tumor angiogenesis.JCI Insight. 2018 Apr 19;3(8):e97349. doi: 10.1172/jci.insight.97349. eCollection 2018 Apr 19.
• [2] ETV2 mediates endothelial transdifferentiation of glioblastoma.Signal Transduct Target Ther. 2018 Feb 9;3:4. doi: 10.1038/s41392-018-0007-8. eCollection 2018.
• [3] Cooperation between ETS variant 2 and Jumonji domaincontaining 2 histone demethylases.Mol Med Rep. 2018 Apr;17(4):5518-5527. doi: 10.3892/mmr.2018.8507. Epub 2018 Jan 26.
• [4] ETV2/ER71 Transcription Factor as a Therapeutic Vehicle for Cardiovascular Disease.Theranostics. 2019 Aug 9;9(19):5694-5705. doi: 10.7150/thno.35300. eCollection 2019.
• [5] In vivo transduction of ETV2 improves cardiac function and induces vascular regeneration following myocardial infarction.Exp Mol Med. 2019 Feb 12;51(2):1-14. doi: 10.1038/s12276-019-0206-6.
• [6] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [7] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [8] Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.