Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTPYEXDM)

• DOT Name: Specifically androgen-regulated gene protein (C1ORF116)
• Gene Name: C1ORF116
• Related Disease:
  Prostate cancer
  Prostate carcinoma
• UniProt ID: SARG_HUMAN
• Pfam ID: PF15385
• Sequence:
  MPERELWPAGTGSEPVTRVGSCDSMMSSTSTRSGSSDSSYDFLSTEEKECLLFLEETIGS
  LDTEADSGLSTDESEPATTPRGFRALPITQPTPRGGPEETITQQGRTPRTVTESSSSHPP
  EPQGLGLRSGSYSLPRNIHIARSQNFRKSTTQASSHNPGEPGRLAPEPEKEQVSQSSQPR
  QAPASPQEAALDLDVVLIPPPEAFRDTQPEQCREASLPEGPGQQGHTPQLHTPSSSQERE
  QTPSEAMSQKAKETVSTRYTQPQPPPAGLPQNARAEDAPLSSGEDPNSRLAPLTTPKPRK
  LPPNIVLKSSRSSFHSDPQHWLSRHTEAAPGDSGLISCSLQEQRKARKEALEKLGLPQDQ
  DEPGLHLSKPTSSIRPKETRAQHLSPAPGLAQPAAPAQASAAIPAAGKALAQAPAPAPGP
  AQGPLPMKSPAPGNVAASKSMPISIPKAPRANSALTPPKPESGLTLQESNTPGLRQMNFK
  SNTLERSGVGLSSYLSTEKDASPKTSTSLGKGSFLDKISPSVLRNSRPRPASLGTGKDFA
  GIQVGKLADLEQEQSSKRLSYQGQSRDKLPRPPCVSVKISPKGVPNEHRREALKKLGLLK
  E
• Function: Putative androgen-specific receptor.
• Tissue Specificity: Highly expressed in prostate.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Prostate cancer	DISF190Y	Strong	Altered Expression	[1]
Prostate carcinoma	DISMJPLE	Strong	Altered Expression	[1]

13 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Specifically androgen-regulated gene protein (C1ORF116).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Specifically androgen-regulated gene protein (C1ORF116).	[3]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Specifically androgen-regulated gene protein (C1ORF116).	[4]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Specifically androgen-regulated gene protein (C1ORF116).	[5]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Specifically androgen-regulated gene protein (C1ORF116).	[6]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Specifically androgen-regulated gene protein (C1ORF116).	[7]
Enzalutamide	DMGL19D	Approved	Enzalutamide decreases the expression of Specifically androgen-regulated gene protein (C1ORF116).	[9]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Specifically androgen-regulated gene protein (C1ORF116).	[10]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Specifically androgen-regulated gene protein (C1ORF116).	[9]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Specifically androgen-regulated gene protein (C1ORF116).	[11]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Specifically androgen-regulated gene protein (C1ORF116).	[13]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Specifically androgen-regulated gene protein (C1ORF116).	[14]
[3H]methyltrienolone	DMTSGOW	Investigative	[3H]methyltrienolone increases the expression of Specifically androgen-regulated gene protein (C1ORF116).	[15]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Marinol	DM70IK5	Approved	Marinol increases the glycosylation of Specifically androgen-regulated gene protein (C1ORF116).	[8]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Specifically androgen-regulated gene protein (C1ORF116).	[12]

References

• [1] Identifying global expression patterns and key regulators in epithelial to mesenchymal transition through multi-study integration.BMC Cancer. 2017 Jun 26;17(1):447. doi: 10.1186/s12885-017-3413-3.
• [2] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [3] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [4] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [5] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [6] Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
• [7] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [8] Epigenetic activation of O-linked -N-acetylglucosamine transferase overrides the differentiation blockage in acute leukemia. EBioMedicine. 2020 Apr;54:102678. doi: 10.1016/j.ebiom.2020.102678. Epub 2020 Apr 6.
• [9] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [10] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [11] A novel long noncoding RNA AK001796 acts as an oncogene and is involved in cell growth inhibition by resveratrol in lung cancer. Toxicol Appl Pharmacol. 2015 Jun 1;285(2):79-88.
• [12] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [13] Low dose of bisphenol a modulates ovarian cancer gene expression profile and promotes epithelial to mesenchymal transition via canonical Wnt pathway. Toxicol Sci. 2018 Aug 1;164(2):527-538.
• [14] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [15] Gene expression signature-based chemical genomic prediction identifies a novel class of HSP90 pathway modulators. Cancer Cell. 2006 Oct;10(4):321-30.