Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQK3AKI)

DOT Name	Testis-specific Y-encoded protein 3 (TSPY3)
Gene Name	TSPY3
Related Disease	46,XY complete gonadal dysgenesis ( ) Adult germ cell tumor ( ) Advanced cancer ( ) Alzheimer disease ( ) Breast cancer ( ) Breast carcinoma ( ) Complete androgen insensitivity syndrome ( ) Disorder of sexual differentiation ( ) Germ cell tumor ( ) Germ cell tumour ( ) Hematologic disease ( ) Male infertility ( ) Malignant germ cell tumor ( ) Neoplasm ( ) Prostate cancer ( ) Prostate carcinoma ( ) Prostate neoplasm ( ) Systemic sclerosis ( ) Testicular cancer ( ) Carcinoma of liver and intrahepatic biliary tract ( ) Hepatocellular carcinoma ( ) Liver cancer ( ) Seminoma ( )
UniProt ID	TSPY3_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF00956
Sequence	MRPEGSLTYRVPERLRQGFCGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALG EEAVLLLDDIMAEVEVVAEEEGLVERREEAQRAQQAVPGPGPMTPESALEELLAVQVELE PVNAQARKAFSRQREKMERRRKPHLDRRGAVIQSVPGFWANVIANHPQMSALITDEDEDM LSYMVSLEVEEEKHPVHLCKIMLFFRSNPYFQNKVITKEYLVNITEYRASHSTPIEWYPD YEVEAYRRRHHNSSLNFFNWFSDHNFAGSNKIAEILCKDLWRNPLQYYKRMKPPEEGTET SGDSQLLS
Function	May be involved in sperm differentiation and proliferation.

Molecular Interaction Atlas (MIA) of This DOT

23 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
46,XY complete gonadal dysgenesis	DISLF3LT	Strong	Altered Expression	[1]
Adult germ cell tumor	DISJUCQ7	Strong	Biomarker	[2]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[1]
Alzheimer disease	DISF8S70	Strong	Biomarker	[3]
Breast cancer	DIS7DPX1	Strong	Biomarker	[4]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[4]
Complete androgen insensitivity syndrome	DISQL418	Strong	Biomarker	[1]
Disorder of sexual differentiation	DISRMAEZ	Strong	Biomarker	[1]
Germ cell tumor	DIS62070	Strong	Genetic Variation	[5]
Germ cell tumour	DISOF3TK	Strong	Biomarker	[2]
Hematologic disease	DIS9XD9A	Strong	Genetic Variation	[6]
Male infertility	DISY3YZZ	Strong	Genetic Variation	[7]
Malignant germ cell tumor	DISTDR2M	Strong	Biomarker	[8]
Neoplasm	DISZKGEW	Strong	Genetic Variation	[9]
Prostate cancer	DISF190Y	Strong	Biomarker	[10]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[10]
Prostate neoplasm	DISHDKGQ	Strong	Genetic Variation	[11]
Systemic sclerosis	DISF44L6	Strong	Biomarker	[12]
Testicular cancer	DIS6HNYO	Strong	Biomarker	[13]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	moderate	Altered Expression	[14]
Hepatocellular carcinoma	DIS0J828	moderate	Altered Expression	[15]
Liver cancer	DISDE4BI	moderate	Altered Expression	[14]
Seminoma	DIS3J8LJ	Limited	Altered Expression	[16]
------------------------------------------------------------------------------------


⏷ Show the Full List of 23 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Testis-specific Y-encoded protein 3 (TSPY3).	[17]
------------------------------------------------------------------------------------

References

1	Gonadoblastoma Y locus genes expressed in germ cells of individuals with dysgenetic gonads and a Y chromosome in their karyotypes include DDX3Y and TSPY.Hum Reprod. 2019 Apr 1;34(4):770-779. doi: 10.1093/humrep/dez004.
2	Testis-specific protein Y-encoded gene is expressed in early and late stages of gonadoblastoma and testicular carcinoma in situ.Urol Oncol. 2007 Mar-Apr;25(2):141-6. doi: 10.1016/j.urolonc.2006.08.002.
3	Male microchimerism in the human female brain.PLoS One. 2012;7(9):e45592. doi: 10.1371/journal.pone.0045592. Epub 2012 Sep 26.
4	Fetal microchimerism in breast from women with and without breast cancer.Breast Cancer Res Treat. 2010 May;121(1):241-4. doi: 10.1007/s10549-009-0548-1. Epub 2009 Sep 19.
5	SRY mutation analysis by next generation (deep) sequencing in a cohort of chromosomal Disorders of Sex Development (DSD) patients with a mosaic karyotype.BMC Med Genet. 2012 Nov 16;13:108. doi: 10.1186/1471-2350-13-108.
6	Long-term persistence of hemopoietic chimerism following sex-mismatched bone marrow transplantation.Bone Marrow Transplant. 1997 Dec;20(11):969-73. doi: 10.1038/sj.bmt.1701011.
7	TSPY gene copy number as a potential new risk factor for male infertility.Reprod Biomed Online. 2007 May;14(5):579-87. doi: 10.1016/s1472-6483(10)61049-8.
8	45,X/46,X,psu dic(Y) gonadal dysgenesis: influence of the two cell lines on the clinical phenotype, including gonadal histology.Sex Dev. 2013;7(6):282-8. doi: 10.1159/000356173. Epub 2013 Nov 13.
9	Ullrich-Turner Syndrome and Tumor Risk: Is There Another Chance to Early Gonadectomy in Positive TSPY and SRY Patients?.Eur J Pediatr Surg. 2016 Jun;26(3):273-6. doi: 10.1055/s-0035-1551568. Epub 2015 May 15.
10	Localization of candidate genes in a region of high frequency of microvariant alleles for prostate cancer susceptibility: the chromosome region Yp11.2 genetic variation.DNA Cell Biol. 2010 Jan;29(1):3-7. doi: 10.1089/dna.2009.0905.
11	Detection of recurrent copy number loss at Yp11.2 involving TSPY gene cluster in prostate cancer using array-based comparative genomic hybridization.Cancer Res. 2006 Apr 15;66(8):4055-64. doi: 10.1158/0008-5472.CAN-05-3822.
12	Male microchimerism in women with systemic sclerosis and healthy women who have never given birth to a son.Ann Rheum Dis. 2005 Jun;64(6):845-8. doi: 10.1136/ard.2004.029314. Epub 2004 Nov 18.
13	TSPY is a cancer testis antigen expressed in human hepatocellular carcinoma.Br J Cancer. 2005 Aug 22;93(4):458-63. doi: 10.1038/sj.bjc.6602716.
14	TSPY potentiates cell proliferation and tumorigenesis by promoting cell cycle progression in HeLa and NIH3T3 cells.BMC Cancer. 2006 Jun 9;6:154. doi: 10.1186/1471-2407-6-154.
15	The Y-linked proto-oncogene TSPY contributes to poor prognosis of the male hepatocellular carcinoma patients by promoting the pro-oncogenic and suppressing the anti-oncogenic gene expression.Cell Biosci. 2019 Mar 4;9:22. doi: 10.1186/s13578-019-0287-x. eCollection 2019.
16	The Y-encoded TSPY protein: a significant marker potentially plays a role in the pathogenesis of testicular germ cell tumors.Hum Pathol. 2007 Oct;38(10):1470-81. doi: 10.1016/j.humpath.2007.03.011. Epub 2007 May 22.
17	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.