Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQKJR81)

DOT Name Breast carcinoma-amplified sequence 1 (BCAS1)
Synonyms Amplified and overexpressed in breast cancer; Novel amplified in breast cancer 1
Gene Name BCAS1
Related Disease
Advanced cancer ( )
Breast cancer ( )
Breast neoplasm ( )
Colorectal neoplasm ( )
Familial prostate carcinoma ( )
Prostate cancer ( )
Prostate cancer, hereditary, 1 ( )
Prostate neoplasm ( )
Schizophrenia ( )
Breast carcinoma ( )
UniProt ID
BCAS1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MGNQMSVPQRVEDQENEPEAETYQDNASALNGVPVVVSTHTVQHLEEVDLGISVKTDNVA
TSSPETTEISAVADANGKNLGKEAKPEAPAAKSRFFLMLSRPVPGRTGDQAADSSLGSVK
LDVSSNKAPANKDPSESWTLPVAAGPGQDTDKTPGHAPAQDKVLSAARDPTLLPPETGGA
GGEAPSKPKDSSFFDKFFKLDKGQEKVPGDSQQEAKRAEHQDKVDEVPGLSGQSDDVPAG
KDIVDGKEKEGQELGTADCSVPGDPEGLETAKDDSQAAAIAENNNSIMSFFKTLVSPNKA
ETKKDPEDTGAEKSPTTSADLKSDKANFTSQETQGAGKNSKGCNPSGHTQSVTTPEPAKE
GTKEKSGPTSLPLGKLFWKKSVKEDSVPTGAEENVVCESPVEIIKSKEVESALQTVDLNE
GDAAPEPTEAKLKREESKPRTSLMAFLRQMSVKGDGGITHSEEINGKDSSCQTSDSTEKT
ITPPEPEPTGAPQKGKEGSSKDKKSAAEMNKQKSNKQEAKEPAQCTEQATVDTNSLQNGD
KLQKRPEKRQQSLGGFFKGLGPKRMLDAQVQTDPVSIGPVGKSK
Function Required for myelination.
Tissue Specificity
Highly expressed in the brain and, more specifically, in oligodendrocytes (at protein level). Expressed in the prostate, and at lower levels in testis, intestine and colon. Overexpressed in most breast cancer cell lines and down-regulated in some colorectal tumors.

Molecular Interaction Atlas (MIA) of This DOT

10 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Advanced cancer DISAT1Z9 Strong Altered Expression [1]
Breast cancer DIS7DPX1 Strong Biomarker [2]
Breast neoplasm DISNGJLM Strong Altered Expression [3]
Colorectal neoplasm DISR1UCN Strong Altered Expression [4]
Familial prostate carcinoma DISL9KNO Strong Biomarker [5]
Prostate cancer DISF190Y Strong Biomarker [6]
Prostate cancer, hereditary, 1 DISE2P4L Strong Biomarker [5]
Prostate neoplasm DISHDKGQ Strong Biomarker [6]
Schizophrenia DISSRV2N Strong Biomarker [7]
Breast carcinoma DIS2UE88 Limited Biomarker [2]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Breast carcinoma-amplified sequence 1 (BCAS1). [8]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Breast carcinoma-amplified sequence 1 (BCAS1). [17]
------------------------------------------------------------------------------------
11 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Breast carcinoma-amplified sequence 1 (BCAS1). [9]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Breast carcinoma-amplified sequence 1 (BCAS1). [10]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Breast carcinoma-amplified sequence 1 (BCAS1). [11]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Breast carcinoma-amplified sequence 1 (BCAS1). [12]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Breast carcinoma-amplified sequence 1 (BCAS1). [13]
Testosterone DM7HUNW Approved Testosterone increases the expression of Breast carcinoma-amplified sequence 1 (BCAS1). [14]
Menadione DMSJDTY Approved Menadione affects the expression of Breast carcinoma-amplified sequence 1 (BCAS1). [15]
Urethane DM7NSI0 Phase 4 Urethane affects the expression of Breast carcinoma-amplified sequence 1 (BCAS1). [16]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Breast carcinoma-amplified sequence 1 (BCAS1). [18]
Mivebresib DMCPF90 Phase 1 Mivebresib decreases the expression of Breast carcinoma-amplified sequence 1 (BCAS1). [19]
[3H]methyltrienolone DMTSGOW Investigative [3H]methyltrienolone increases the expression of Breast carcinoma-amplified sequence 1 (BCAS1). [20]
------------------------------------------------------------------------------------
⏷ Show the Full List of 11 Drug(s)

References

1 Characterization of the novel amplified in breast cancer-1 (NABC1) gene product.Exp Cell Res. 2003 Nov 1;290(2):402-13. doi: 10.1016/s0014-4827(03)00353-7.
2 Cell-free DNA detected by "liquid biopsy" as a potential prognostic biomarker in early breast cancer.Oncotarget. 2017 Mar 7;8(10):16642-16649. doi: 10.18632/oncotarget.15120.
3 Elevated expression levels of NCOA3, TOP1, and TFAP2C in breast tumors as predictors of poor prognosis.Cancer. 2003 Jul 1;98(1):18-23. doi: 10.1002/cncr.11482.
4 NABC1 (BCAS1): alternative splicing and downregulation in colorectal tumors.Genomics. 2000 May 1;65(3):299-302. doi: 10.1006/geno.2000.6172.
5 Association analyses of more than 140,000 men identify 63 new prostate cancer susceptibility loci.Nat Genet. 2018 Jul;50(7):928-936. doi: 10.1038/s41588-018-0142-8. Epub 2018 Jun 11.
6 Analysis of candidate genes for prostate cancer.Hum Hered. 2004;57(4):172-8. doi: 10.1159/000081443.
7 Mice lacking BCAS1, a novel myelin-associated protein, display hypomyelination, schizophrenia-like abnormal behaviors, and upregulation of inflammatory genes in the brain.Glia. 2017 May;65(5):727-739. doi: 10.1002/glia.23129. Epub 2017 Feb 23.
8 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
9 Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
10 Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
11 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
12 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
13 Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
14 Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
15 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
16 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
17 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
18 CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
19 Comprehensive transcriptome profiling of BET inhibitor-treated HepG2 cells. PLoS One. 2022 Apr 29;17(4):e0266966. doi: 10.1371/journal.pone.0266966. eCollection 2022.
20 Analysis of the prostate cancer cell line LNCaP transcriptome using a sequencing-by-synthesis approach. BMC Genomics. 2006 Sep 29;7:246. doi: 10.1186/1471-2164-7-246.