Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQQT2IC)

DOT Name Coiled-coil domain-containing protein 77 (CCDC77)
Gene Name CCDC77
Related Disease
Obesity ( )
UniProt ID
CCD77_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MNFTPTHTPVCRKRTVVSKRGVAVSGPTKRRGMADSLESTPLPSPEDRLAKLHPSKELLE
YYQKKMAECEAENEDLLKKLELYKEACEGQHKLECDLQQREEEIAELQKALSDMQVCLFQ
EREHVLRLYSENDRLRIRELEDKKKIQNLLALVGTDAGEVTYFCKEPPHKVTILQKTIQA
VGECEQSESSAFKADPKISKRRPSRERKESSEHYQRDIQTLILQVEALQAQLGEQTKLSR
EQIEGLIEDRRIHLEEIQVQHQRNQNKIKELTKNLHHTQELLYESTKDFLQLRSENQNKE
KSWMLEKDNLMSKIKQYRVQCKKKEDKIGKVLPVMHESHHAQSEYIKSLKDKLVQEKKLS
NMYQEQCISLEEELARIREEEGMRREIFKDRTNKMGKRLQIMTKRYEALERRRILEVEGF
KTDIKVLRQKLKDLEQMLYKATVNARANQDLALLCEVRDSNRRAHKIQGELKNLKSKVFG
LENELRLC

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Obesity DIS47Y1K Strong Genetic Variation [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Coiled-coil domain-containing protein 77 (CCDC77). [2]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Coiled-coil domain-containing protein 77 (CCDC77). [11]
TAK-243 DM4GKV2 Phase 1 TAK-243 increases the sumoylation of Coiled-coil domain-containing protein 77 (CCDC77). [13]
------------------------------------------------------------------------------------
9 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Coiled-coil domain-containing protein 77 (CCDC77). [3]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Coiled-coil domain-containing protein 77 (CCDC77). [4]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Coiled-coil domain-containing protein 77 (CCDC77). [5]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Coiled-coil domain-containing protein 77 (CCDC77). [6]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Coiled-coil domain-containing protein 77 (CCDC77). [7]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Coiled-coil domain-containing protein 77 (CCDC77). [8]
Azathioprine DMMZSXQ Approved Azathioprine decreases the expression of Coiled-coil domain-containing protein 77 (CCDC77). [9]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Coiled-coil domain-containing protein 77 (CCDC77). [10]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide decreases the expression of Coiled-coil domain-containing protein 77 (CCDC77). [12]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Drug(s)

References

1 Genome-wide SNP and CNV analysis identifies common and low-frequency variants associated with severe early-onset obesity.Nat Genet. 2013 May;45(5):513-7. doi: 10.1038/ng.2607. Epub 2013 Apr 7.
2 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
4 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
5 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
6 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
7 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
8 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
9 A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
10 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
11 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
12 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
13 Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.