Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQSQMUQ)

DOT Name	Relaxin-3 (RLN3)
Synonyms	Insulin-like peptide INSL7; Insulin-like peptide 7; Prorelaxin H3
Gene Name	RLN3
Related Disease	Nervous system disease ( ) Depression ( ) Dilated cardiomyopathy 1A ( ) Hyperplasia ( ) Major depressive disorder ( ) Myocardial ischemia ( ) Type-1/2 diabetes ( ) Eating disorder ( ) Ebola virus infection ( ) Obesity ( )
UniProt ID	REL3_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	2FHW; 2K1V
Pfam ID	PF00049
Sequence	MARYMLLLLLAVWVLTGELWPGAEARAAPYGVRLCGREFIRAVIFTCGGSRWRRSDILAH EAMGDTFPDADADEDSLAGELDEAMGSSEWLALTKSPQAFYRGRPSWQGTPGVLRGSRDV LAGLSSSCCKWGCSKSEISSLC
Function	May play a role in neuropeptide signaling processes. Ligand for LGR7, RXFP3 and RXFP4.
KEGG Pathway	Neuroactive ligand-receptor interaction (hsa04080 ) Relaxin sig.ling pathway (hsa04926 )
Reactome Pathway	G alpha (i) signalling events (R-HSA-418594 ) Relaxin receptors (R-HSA-444821 ) G alpha (s) signalling events (R-HSA-418555 )

Molecular Interaction Atlas (MIA) of This DOT

10 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Nervous system disease	DISJ7GGT	Definitive	Biomarker	[1]
Depression	DIS3XJ69	Strong	Biomarker	[2]
Dilated cardiomyopathy 1A	DIS0RK9Z	Strong	Biomarker	[3]
Hyperplasia	DISK4DFB	Strong	Therapeutic	[4]
Major depressive disorder	DIS4CL3X	Strong	Biomarker	[2]
Myocardial ischemia	DISFTVXF	Strong	Therapeutic	[4]
Type-1/2 diabetes	DISIUHAP	Strong	Biomarker	[3]
Eating disorder	DISVGXN0	moderate	Biomarker	[5]
Ebola virus infection	DISJAVM1	Limited	Biomarker	[6]
Obesity	DIS47Y1K	Limited	Genetic Variation	[7]
------------------------------------------------------------------------------------


⏷ Show the Full List of 10 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Relaxin-3 (RLN3).	[8]
------------------------------------------------------------------------------------

References

1	Distinct but overlapping binding sites of agonist and antagonist at the relaxin family peptide 3 (RXFP3) receptor.J Biol Chem. 2018 Oct 12;293(41):15777-15789. doi: 10.1074/jbc.RA118.002645. Epub 2018 Aug 21.
2	Intranasal administration of a stapled relaxin-3 mimetic has anxiolytic- and antidepressant-like activity in rats.Br J Pharmacol. 2019 Oct;176(20):3899-3923. doi: 10.1111/bph.14774. Epub 2019 Sep 11.
3	H3 Relaxin Protects Against Myocardial Injury in Experimental Diabetic Cardiomyopathy by Inhibiting Myocardial Apoptosis, Fibrosis and Inflammation.Cell Physiol Biochem. 2017;43(4):1311-1324. doi: 10.1159/000481843. Epub 2017 Oct 9.
4	Effect of relaxin on myocardial ischemia injury induced by isoproterenol.Peptides. 2005 Sep;26(9):1632-9. doi: 10.1016/j.peptides.2005.02.008.
5	Modulation of feeding by chronic rAAV expression of a relaxin-3 peptide agonist in rat hypothalamus.Gene Ther. 2013 Jul;20(7):703-16. doi: 10.1038/gt.2012.83. Epub 2012 Nov 8.
6	Functional expression of mouse relaxin and mouse relaxin-3 in the lung from an Ebola virus glycoprotein-pseudotyped lentivirus via tracheal delivery.Endocrinology. 2006 Aug;147(8):3797-808. doi: 10.1210/en.2006-0028. Epub 2006 May 18.
7	Discovery of a small molecule RXFP3/4 agonist that increases food intake in rats upon acute central administration.Bioorg Med Chem Lett. 2019 Apr 15;29(8):991-994. doi: 10.1016/j.bmcl.2019.02.013. Epub 2019 Feb 11.
8	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.