Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQTOA4D)

• DOT Name: Uncharacterized protein C1orf53 (C1ORF53)
• Gene Name: C1ORF53
• UniProt ID: CA053_HUMAN
• Pfam ID: PF17653
• Sequence:
  MAARQIWARTGAALCRQPSAAPPPAPLWVRAGFRQQLSLTLCPANEGNCGGSAPSTPGRP
  ERAARPSVSEELTAAERQIAELHAAACAAGQLNYVDPATGYVVLTQIAHLQRGECCGSAC
  RHCPYGQVNVKDPSKKKQFNSYFYV
• Tissue Specificity: Expressed in retina and retinoblastoma.

Molecular Interaction Atlas (MIA) of This DOT

15 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Uncharacterized protein C1orf53 (C1ORF53).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Uncharacterized protein C1orf53 (C1ORF53).	[2]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Uncharacterized protein C1orf53 (C1ORF53).	[3]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Uncharacterized protein C1orf53 (C1ORF53).	[4]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Uncharacterized protein C1orf53 (C1ORF53).	[3]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Uncharacterized protein C1orf53 (C1ORF53).	[5]
Panobinostat	DM58WKG	Approved	Panobinostat decreases the expression of Uncharacterized protein C1orf53 (C1ORF53).	[6]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Uncharacterized protein C1orf53 (C1ORF53).	[6]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Uncharacterized protein C1orf53 (C1ORF53).	[7]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Uncharacterized protein C1orf53 (C1ORF53).	[2]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Uncharacterized protein C1orf53 (C1ORF53).	[8]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Uncharacterized protein C1orf53 (C1ORF53).	[9]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Uncharacterized protein C1orf53 (C1ORF53).	[10]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Uncharacterized protein C1orf53 (C1ORF53).	[11]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Uncharacterized protein C1orf53 (C1ORF53).	[12]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [4] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [5] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [6] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [7] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [8] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [9] Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.
• [10] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [11] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [12] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.