Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTRG0AGH)

• DOT Name: SCAN domain-containing protein 1 (SCAND1)
• Gene Name: SCAND1
• Related Disease:
  Neoplasm
  Prostate cancer
  Prostate carcinoma
• UniProt ID: SCND1_HUMAN
• Pfam ID: PF02023
• Sequence:
  MAATEPILAATGSPAAVPPEKLEGAGSSSAPERNCVGSSLPEASPPAPEPSSPNAAVPEA
  IPTPRAAASAALELPLGPAPVSVAPQAEAEARSTPGPAGSRLGPETFRQRFRQFRYQDAA
  GPREAFRQLRELSRQWLRPDIRTKEQIVEMLVQEQLLAILPEAARARRIRRRTDVRITG
• Function: May regulate transcriptional activity.

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Neoplasm	DISZKGEW	Strong	Altered Expression	[1]
Prostate cancer	DISF190Y	Strong	Biomarker	[1]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[1]

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of SCAN domain-containing protein 1 (SCAND1).	[2]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of SCAN domain-containing protein 1 (SCAND1).	[3]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of SCAN domain-containing protein 1 (SCAND1).	[4]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of SCAN domain-containing protein 1 (SCAND1).	[5]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of SCAN domain-containing protein 1 (SCAND1).	[6]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of SCAN domain-containing protein 1 (SCAND1).	[7]
Menadione	DMSJDTY	Approved	Menadione affects the expression of SCAN domain-containing protein 1 (SCAND1).	[8]
Phenol	DM1QSM3	Phase 2/3	Phenol decreases the expression of SCAN domain-containing protein 1 (SCAND1).	[9]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of SCAN domain-containing protein 1 (SCAND1).	[10]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the phosphorylation of SCAN domain-containing protein 1 (SCAND1).	[11]

References

• [1] MZF1 and SCAND1 Reciprocally Regulate CDC37 Gene Expression in Prostate Cancer.Cancers (Basel). 2019 Jun 8;11(6):792. doi: 10.3390/cancers11060792.
• [2] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [3] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [4] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [5] Minimal peroxide exposure of neuronal cells induces multifaceted adaptive responses. PLoS One. 2010 Dec 17;5(12):e14352. doi: 10.1371/journal.pone.0014352.
• [6] The contribution of methotrexate exposure and host factors on transcriptional variance in human liver. Toxicol Sci. 2007 Jun;97(2):582-94.
• [7] Gene induction and apoptosis in human hepatocellular carci-noma cells SMMC-7721 exposed to 5-aza-2'-deoxycytidine. Chin Med J (Engl). 2007 Sep 20;120(18):1626-31.
• [8] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [9] Classification of heavy-metal toxicity by human DNA microarray analysis. Environ Sci Technol. 2007 May 15;41(10):3769-74.
• [10] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [11] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.