Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSNE9EQ)

• DOT Name: Golgin subfamily A member 8A (GOLGA8A)
• Synonyms: 88 kDa Golgi matrix protein; GM88; GM88 autoantigen
• Gene Name: GOLGA8A
• Related Disease:
  Obsessive compulsive disorder
  Schizophrenia
• UniProt ID: GOG8A_HUMAN
• Pfam ID: PF19046 ; PF15070
• Sequence:
  MLPVDGEERKSEGSDTEGDRTSPCAVSSATLKDLEVGGSGRRCSDPAGQPSNLLPQRGLG
  APLPAETAHTQPSPNDRSLYLSPKSSSASSSLHARQSPCQEQAAVLNSRSIKISRLNDTI
  KSLKQQKKQVEHQLEEEKKANNEKQKAERELEGQIQRLNTEKKKLNTDLYHMKHSLRYFE
  EESKDLAGRLQRSSQRIGELEWSLCAVAATQKKKPDGFSSRSKALLKRQLEQSIREQILL
  KGHVTQLKESLKEVQLERDQYAEQIKGERAQWQQRMRKMSQEVCTLKEEKKHDTHRVEEL
  ERSLSRLKNQMAEPLPPDAPAVSSEVELQDLRKELERVAGELQAQVENNQCISLLNRGQK
  ERLREQEERLQEQQERLREREKRLQQLAEPQSDLEELKHENKSALQLEQQVKELQEKLGQ
  VMETLTSAEKEPEAAVPASGTGGESSGLMDLLEEKADLREHVEKLELGFIQYRRERCHQK
  VHRLLTEPGDSAKDASPGGGHHQAGPGQGGEEGEAAGAAGDGVAACGSYSEGHGKFLAAA
  RNPAAEPSPGAPAPQELGAADKHGDLCEASLTNSVEPAQGEAREGSSQDNPTAQPVVQLL
  GEMQDHQEHPGLGSNCCVPCFCWAWLPRRRR
• Function: May be involved in maintaining Golgi structure.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Obsessive compulsive disorder	DIS1ZMM2	Strong	Biomarker	[1]
Schizophrenia	DISSRV2N	Strong	Biomarker	[1]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Golgin subfamily A member 8A (GOLGA8A) affects the response to substance of Cisplatin.	[16]

17 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Golgin subfamily A member 8A (GOLGA8A).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Golgin subfamily A member 8A (GOLGA8A).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Golgin subfamily A member 8A (GOLGA8A).	[5]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Golgin subfamily A member 8A (GOLGA8A).	[6]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Golgin subfamily A member 8A (GOLGA8A).	[7]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Golgin subfamily A member 8A (GOLGA8A).	[8]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Golgin subfamily A member 8A (GOLGA8A).	[9]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone decreases the expression of Golgin subfamily A member 8A (GOLGA8A).	[10]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene decreases the expression of Golgin subfamily A member 8A (GOLGA8A).	[4]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Golgin subfamily A member 8A (GOLGA8A).	[6]
PMID27336223-Compound-5	DM6E50A	Patented	PMID27336223-Compound-5 decreases the expression of Golgin subfamily A member 8A (GOLGA8A).	[10]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Golgin subfamily A member 8A (GOLGA8A).	[11]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Golgin subfamily A member 8A (GOLGA8A).	[12]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Golgin subfamily A member 8A (GOLGA8A).	[13]
OXYQUINOLINE	DMZVS9Y	Investigative	OXYQUINOLINE decreases the expression of Golgin subfamily A member 8A (GOLGA8A).	[7]
Resorcinol	DMM37C0	Investigative	Resorcinol increases the expression of Golgin subfamily A member 8A (GOLGA8A).	[14]
2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE	DMNQL17	Investigative	2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE decreases the expression of Golgin subfamily A member 8A (GOLGA8A).	[15]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the methylation of Golgin subfamily A member 8A (GOLGA8A).	[3]

References

• [1] Blood-based dynamic genomic signature for obsessive-compulsive disorder.Am J Med Genet B Neuropsychiatr Genet. 2018 Dec;177(8):709-716. doi: 10.1002/ajmg.b.32675. Epub 2018 Oct 23.
• [2] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [3] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [4] Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
• [5] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [6] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [7] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [8] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [9] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [10] PPARgamma controls CD1d expression by turning on retinoic acid synthesis in developing human dendritic cells. J Exp Med. 2006 Oct 2;203(10):2351-62.
• [11] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [12] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [13] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [14] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [15] Preferential induction of the AhR gene battery in HepaRG cells after a single or repeated exposure to heterocyclic aromatic amines. Toxicol Appl Pharmacol. 2010 Nov 15;249(1):91-100.
• [16] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.