Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSVIW9K)

DOT Name Uncharacterized protein C15orf39 (C15ORF39)
Gene Name C15ORF39
UniProt ID
CO039_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF17663
Sequence
MAEKRPLRTLGPVMYGKLPRLETDSGLEHSLPHSVGNQDPCTYKGSYFSCPMAGTPKAES
EQLASWTPYPPLYSTGMAGPPLQADNLLTNCLFYRSPAEGPEKMQDSSPVELLPFSPQAH
SYPGPPLAAPKPVYRNPLCYGLSTCLGEGAVKRPLDVDWTLATGPLLPSADPPCSLAPAP
SKGQTLDGTFLRGVPAEGSSKDSSGSFSPCQPFLEKYQTIHSTGFLASRYTGPYPRNSKQ
AMSEGPSSPWTQLAQPLGPPCQDTGPTHYPPPHHPPPHPPQALPCPPACRHPEKQGSYSP
ALPLQPLGGHKGTGYQAGGLGSPYLRQQAAQAPYIPPLGLDAYPYPSAPLPAPSPGLKLE
PPLTPRCPLDFAPQTLSFPYARDDLSLYGASPGLGGTPPSQNNVRAVPQPGAFQRACQPL
PASQPCSEPVRPAQEAEEKTWLPSCRKEKLQPRLSEHSGPPIVIRDSPVPCTPPALPPCA
RECQSLPQKEGARPPSSPPMPVIDNVFSLAPYRDYLDVPAPEATTEPDSATAEPDSAPAT
SEGQDKGCRGTLPAQEGPSGSKPLRGSLKEEVALDLSVRKPTAEASPVKASRSVEHAKPT
AAMDVPDVGNMVSDLPGLKKIDTEAPGLPGVPVTTDAMPRTNFHSSVAFMFRKFKILRPA
PLPAAVVPSTPTSAPAPTQPAPTPTSGPIGLRILAQQPLSVTCFSLALPSPPAVAVASPA
PAPAPSPAPARAQAPASARDPAPAPAPVAGPAPASTSAPGDSLEQHFTGLHASLCDAISG
SVAHSPPEKLREWLETAGPWGQAAWQDCQGVQGLLAKLLSQLQRFDRTHRCPFPHVVRAG
AIFVPIHLVKERLFPRLPPASVDHVLQEHRVELRPTTLSEERALRELALPGCTSRMLKLL
ALRQLPDIYPDLLGLQWRDCVRRQLGDFDTEAGAVSSSEPTVARGEPESLALAQKSPAPK
VRKPGRKPPTPGPEKAEAAAGEESCGASPTPATSASPPGPTLKARFRSLLETAWLNGLAL
PTWGHKSSRPDQPSPCPQLLDSQSHHL

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
5 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Uncharacterized protein C15orf39 (C15ORF39). [1]
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of Uncharacterized protein C15orf39 (C15ORF39). [7]
TAK-243 DM4GKV2 Phase 1 TAK-243 increases the sumoylation of Uncharacterized protein C15orf39 (C15ORF39). [13]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 affects the phosphorylation of Uncharacterized protein C15orf39 (C15ORF39). [14]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Uncharacterized protein C15orf39 (C15ORF39). [15]
------------------------------------------------------------------------------------
13 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Uncharacterized protein C15orf39 (C15ORF39). [2]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Uncharacterized protein C15orf39 (C15ORF39). [3]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Uncharacterized protein C15orf39 (C15ORF39). [4]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Uncharacterized protein C15orf39 (C15ORF39). [5]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Uncharacterized protein C15orf39 (C15ORF39). [6]
Menadione DMSJDTY Approved Menadione affects the expression of Uncharacterized protein C15orf39 (C15ORF39). [8]
Demecolcine DMCZQGK Approved Demecolcine decreases the expression of Uncharacterized protein C15orf39 (C15ORF39). [9]
Lindane DMB8CNL Approved Lindane decreases the expression of Uncharacterized protein C15orf39 (C15ORF39). [10]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Uncharacterized protein C15orf39 (C15ORF39). [11]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of Uncharacterized protein C15orf39 (C15ORF39). [12]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Uncharacterized protein C15orf39 (C15ORF39). [9]
Milchsaure DM462BT Investigative Milchsaure increases the expression of Uncharacterized protein C15orf39 (C15ORF39). [16]
3R14S-OCHRATOXIN A DM2KEW6 Investigative 3R14S-OCHRATOXIN A decreases the expression of Uncharacterized protein C15orf39 (C15ORF39). [10]
------------------------------------------------------------------------------------
⏷ Show the Full List of 13 Drug(s)

References

1 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
3 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
4 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
5 Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
6 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
7 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
8 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
9 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
10 Transcriptome-based functional classifiers for direct immunotoxicity. Arch Toxicol. 2014 Mar;88(3):673-89.
11 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
12 Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
13 Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
14 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
15 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
16 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.