Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTT4OR8G)

• DOT Name: Peroxiredoxin-4 (PRDX4)
• Synonyms: EC 1.11.1.24; Antioxidant enzyme AOE372; AOE37-2; Peroxiredoxin IV; Prx-IV; Thioredoxin peroxidase AO372; Thioredoxin-dependent peroxide reductase A0372; Thioredoxin-dependent peroxiredoxin 4
• Gene Name: PRDX4
• UniProt ID: PRDX4_HUMAN
• PDB ID: 2PN8; 3TJB; 3TJF; 3TJG; 3TJJ; 3TJK; 3TKP; 3TKQ; 3TKR; 3TKS; 4RQX; 5HQP; 8EKW; 8EKY
• EC Number: 1.11.1.24
• Pfam ID: PF10417 ; PF00578
• Sequence:
  MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVY
  PGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDF
  TFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDL
  THQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDK
  HGEVCPAGWKPGSETIIPDPAGKLKYFDKLN
• Function: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Regulates the activation of NF-kappa-B in the cytosol by a modulation of I-kappa-B-alpha phosphorylation.
• Reactome Pathway: Neutrophil degranulation (R-HSA-6798695)

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Etretinate	DM2CZFA	Approved	Peroxiredoxin-4 (PRDX4) increases the Lipid metabolism disorders ADR of Etretinate.	[21]
Deoxycholic acid	DM3GYAL	Approved	Peroxiredoxin-4 (PRDX4) decreases the response to substance of Deoxycholic acid.	[22]

20 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Peroxiredoxin-4 (PRDX4).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Peroxiredoxin-4 (PRDX4).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Peroxiredoxin-4 (PRDX4).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Peroxiredoxin-4 (PRDX4).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Peroxiredoxin-4 (PRDX4).	[5]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Peroxiredoxin-4 (PRDX4).	[6]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Peroxiredoxin-4 (PRDX4).	[7]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Peroxiredoxin-4 (PRDX4).	[8]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Peroxiredoxin-4 (PRDX4).	[9]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Peroxiredoxin-4 (PRDX4).	[10]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Peroxiredoxin-4 (PRDX4).	[11]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Peroxiredoxin-4 (PRDX4).	[12]
Gallium nitrate	DMF9O6B	Approved	Gallium nitrate decreases the expression of Peroxiredoxin-4 (PRDX4).	[13]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of Peroxiredoxin-4 (PRDX4).	[14]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Peroxiredoxin-4 (PRDX4).	[16]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Peroxiredoxin-4 (PRDX4).	[17]
Steroid derivative 1	DMB0NVQ	Patented	Steroid derivative 1 increases the expression of Peroxiredoxin-4 (PRDX4).	[6]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Peroxiredoxin-4 (PRDX4).	[18]
AHPN	DM8G6O4	Investigative	AHPN increases the expression of Peroxiredoxin-4 (PRDX4).	[19]
Bilirubin	DMI0V4O	Investigative	Bilirubin decreases the expression of Peroxiredoxin-4 (PRDX4).	[20]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Peroxiredoxin-4 (PRDX4).	[15]

References

• [1] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Increased mitochondrial ROS formation by acetaminophen in human hepatic cells is associated with gene expression changes suggesting disruption of the mitochondrial electron transport chain. Toxicol Lett. 2015 Apr 16;234(2):139-50.
• [4] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [5] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [6] Involvement of peroxiredoxin IV in the 16alpha-hydroxyestrone-induced proliferation of human MCF-7 breast cancer cells. Cell Biol Int. 2008 Apr;32(4):401-5. doi: 10.1016/j.cellbi.2007.12.009. Epub 2008 Jan 10.
• [7] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [8] Protein expression profiling identifies molecular targets of quercetin as a major dietary flavonoid in human colon cancer cells. Proteomics. 2004 Jul;4(7):2160-74.
• [9] Proteomic and functional analyses reveal a dual molecular mechanism underlying arsenic-induced apoptosis in human multiple myeloma cells. J Proteome Res. 2009 Jun;8(6):3006-19.
• [10] Chromium III histidinate exposure modulates gene expression in HaCaT human keratinocytes exposed to oxidative stress. Biol Trace Elem Res. 2010 Oct;137(1):23-39.
• [11] Proteomic analysis revealed association of aberrant ROS signaling with suberoylanilide hydroxamic acid-induced autophagy in Jurkat T-leukemia cells. Autophagy. 2010 Aug;6(6):711-24. doi: 10.4161/auto.6.6.12397. Epub 2010 Aug 17.
• [12] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [13] Role of oxidative stress in the induction of metallothionein-2A and heme oxygenase-1 gene expression by the antineoplastic agent gallium nitrate in human lymphoma cells. Free Radic Biol Med. 2008 Sep 15;45(6):763-72.
• [14] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [15] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [16] BET bromodomain inhibition targets both c-Myc and IL7R in high-risk acute lymphoblastic leukemia. Blood. 2012 Oct 4;120(14):2843-52.
• [17] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [18] Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.
• [19] ST1926, a novel and orally active retinoid-related molecule inducing apoptosis in myeloid leukemia cells: modulation of intracellular calcium homeostasis. Blood. 2004 Jan 1;103(1):194-207.
• [20] Global changes in gene regulation demonstrate that unconjugated bilirubin is able to upregulate and activate select components of the endoplasmic reticulum stress response pathway. J Biochem Mol Toxicol. 2010 Mar-Apr;24(2):73-88.
• [21] ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.
• [22] Development and molecular characterization of HCT-116 cell lines resistant to the tumor promoter and multiple stress-inducer, deoxycholate. Carcinogenesis. 2002 Dec;23(12):2063-80. doi: 10.1093/carcin/23.12.2063.