Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTTFA8FH)

DOT Name	Mitochondrial import receptor subunit TOM22 homolog (TOMM22)
Synonyms	hTom22; 1C9-2; Translocase of outer membrane 22 kDa subunit homolog
Gene Name	TOMM22
UniProt ID	TOM22_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	7CK6; 7CP9; 7VBY; 7VC4; 7VD2; 7VDD
Pfam ID	PF04281
Sequence	MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVR SAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQIL LGPNTGLSGGMPGALPSLPGKI
Function	Central receptor component of the translocase of the outer membrane of mitochondria (TOM complex) responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with the peripheral receptor TOM20 functions as the transit peptide receptor and facilitates the movement of preproteins into the translocation pore. Required for the translocation across the mitochondrial outer membrane of cytochrome P450 monooxygenases.
Tissue Specificity	Ubiquitous.
Reactome Pathway	PINK1-PRKN Mediated Mitophagy (R-HSA-5205685 ) Mitochondrial protein import (R-HSA-1268020 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Mitochondrial import receptor subunit TOM22 homolog (TOMM22).	[1]
Coumarin	DM0N8ZM	Investigative	Coumarin increases the phosphorylation of Mitochondrial import receptor subunit TOM22 homolog (TOMM22).	[9]
------------------------------------------------------------------------------------

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Mitochondrial import receptor subunit TOM22 homolog (TOMM22).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Mitochondrial import receptor subunit TOM22 homolog (TOMM22).	[3]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Mitochondrial import receptor subunit TOM22 homolog (TOMM22).	[4]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Mitochondrial import receptor subunit TOM22 homolog (TOMM22).	[5]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Mitochondrial import receptor subunit TOM22 homolog (TOMM22).	[6]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Mitochondrial import receptor subunit TOM22 homolog (TOMM22).	[7]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Mitochondrial import receptor subunit TOM22 homolog (TOMM22).	[8]
------------------------------------------------------------------------------------


⏷ Show the Full List of 7 Drug(s)

References

1	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2	Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
3	Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
4	Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
5	Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
6	Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
7	Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
8	Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
9	Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.