Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTU5GLCQ)

DOT Name PHD finger protein 21B (PHF21B)
Gene Name PHF21B
Related Disease
Advanced cancer ( )
Colon cancer ( )
Colon carcinoma ( )
Major depressive disorder ( )
Neoplasm ( )
Squamous cell carcinoma ( )
Prostate cancer ( )
Prostate carcinoma ( )
UniProt ID
PF21B_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00628
Sequence
MELQSRPEALAVELARHQNGDLKKQLHERQPRIAALSDKQALGTITAVPVTGPQVSSLQR
LAGQGAAVLPQVRPKTLIPDSLPVAPGRDRPPKQPPTFQKATVVSVKNPSPALPTANNTV
SHVPAPGSQPQALAEPAALASPLSSAGVAYAIISTSPSNAAAMAPSTAVSVVSDSIKVQP
LLISADNKPPPRLLSSPHPATHHCPLHPSSLPLTPPSPSLSPSPLHGIFQVIIIQPQVQT
QPESTAESRPPTEEPSQGAQATKKKKEDRPPTQENPEKIAFMVALGLVTTEHLEEIQSKR
QERKRRSTANPAYSGLLETERKRLASNYLNNPLFLTARANEDPCWKNEITHDEHCAACKR
GANLQPCGTCPGAYHLSCLEPPLKTAPKGVWVCPRCQQKALKKDEGVPWTGMLAIVHSYV
THKTVKEEEKQKLLQRGSELQNEHQQLEERDRRLASAVQKCLELKTSLLARQRGTQSSLD
RLRALLRLIQGEQLLQVTMTTTSPAPLLAGPWTKPSVAATHPTVQHPQGHN

Molecular Interaction Atlas (MIA) of This DOT

8 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Advanced cancer DISAT1Z9 Strong Altered Expression [1]
Colon cancer DISVC52G Strong Altered Expression [2]
Colon carcinoma DISJYKUO Strong Altered Expression [2]
Major depressive disorder DIS4CL3X Strong Biomarker [3]
Neoplasm DISZKGEW Strong Biomarker [1]
Squamous cell carcinoma DISQVIFL Strong Biomarker [2]
Prostate cancer DISF190Y Limited Altered Expression [1]
Prostate carcinoma DISMJPLE Limited Altered Expression [1]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
4 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of PHD finger protein 21B (PHF21B). [4]
Fulvestrant DM0YZC6 Approved Fulvestrant increases the methylation of PHD finger protein 21B (PHF21B). [7]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of PHD finger protein 21B (PHF21B). [8]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the methylation of PHD finger protein 21B (PHF21B). [7]
------------------------------------------------------------------------------------
3 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of PHD finger protein 21B (PHF21B). [5]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of PHD finger protein 21B (PHF21B). [6]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of PHD finger protein 21B (PHF21B). [9]
------------------------------------------------------------------------------------

References

1 PHF21B overexpression promotes cancer stem cell-like traits in prostate cancer cells by activating the Wnt/-catenin signaling pathway.J Exp Clin Cancer Res. 2017 Jun 23;36(1):85. doi: 10.1186/s13046-017-0560-y.
2 PHF21B as a candidate tumor suppressor gene in head and neck squamous cell carcinomas.Mol Oncol. 2015 Feb;9(2):450-62. doi: 10.1016/j.molonc.2014.09.009. Epub 2014 Oct 13.
3 The PHF21B gene is associated with major depression and modulates the stress response.Mol Psychiatry. 2017 Jul;22(7):1015-1025. doi: 10.1038/mp.2016.174. Epub 2016 Oct 25.
4 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
5 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
6 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
7 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
8 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
9 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.