Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTU882I6)

DOT Name Copine-5 (CPNE5)
Synonyms Copine V
Gene Name CPNE5
Related Disease
Advanced cancer ( )
Alcohol dependence ( )
Breast carcinoma ( )
Cardiac failure ( )
Esophageal squamous cell carcinoma ( )
Obesity ( )
UniProt ID
CPNE5_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00168 ; PF07002
Sequence
MEQPEDMASLSEFDSLAGSIPATKVEITVSCRNLLDKDMFSKSDPLCVMYTQGMENKQWR
EFGRTEVIDNTLNPDFVRKFIVDYFFEEKQNLRFDLYDVDSKSPDLSKHDFLGQAFCTLG
EIVGSPGSRLEKPLTIGAFSLNSRTGKPMPAVSNGGVPGKKCGTIILSAEELSNCRDVAT
MQFCANKLDKKDFFGKSDPFLVFYRSNEDGTFTICHKTEVMKNTLNPVWQTFSIPVRALC
NGDYDRTIKVEVYDWDRDGSHDFIGEFTTSYRELARGQSQFNIYEVVNPKKKMKKKKYVN
SGTVTLLSFAVESECTFLDYIKGGTQINFTVAIDFTASNGNPSQSTSLHYMSPYQLNAYA
LALTAVGEIIQHYDSDKMFPALGFGAKLPPDGRVSHEFPLNGNQENPSCCGIDGILEAYH
RSLRTVQLYGPTNFAPVVTHVARNAAAVQDGSQYSVLLIITDGVISDMAQTKEAIVNAAK
LPMSIIIVGVGQAEFDAMVELDGDDVRISSRGKLAERDIVQFVPFRDYVDRTGNHVLSMA
RLARDVLAEIPDQLVSYMKAQGIRPRPPPAAPTHSPSQSPARTPPASPLHTHI
Function Probable calcium-dependent phospholipid-binding protein that may play a role in calcium-mediated intracellular processes. Plays a role in dendrite formation by melanocytes.
Tissue Specificity Expressed in the brain, heart, stomach, spleen, lymph node and testis . Expressed in melanocytes .

Molecular Interaction Atlas (MIA) of This DOT

6 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Advanced cancer DISAT1Z9 Strong Biomarker [1]
Alcohol dependence DIS4ZSCO Strong Genetic Variation [2]
Breast carcinoma DIS2UE88 Strong Genetic Variation [3]
Cardiac failure DISDC067 Strong Genetic Variation [4]
Esophageal squamous cell carcinoma DIS5N2GV Strong Altered Expression [1]
Obesity DIS47Y1K Strong Genetic Variation [2]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Copine-5 (CPNE5). [5]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Copine-5 (CPNE5). [8]
------------------------------------------------------------------------------------
4 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Copine-5 (CPNE5). [6]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Copine-5 (CPNE5). [7]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Copine-5 (CPNE5). [9]
KOJIC ACID DMP84CS Investigative KOJIC ACID increases the expression of Copine-5 (CPNE5). [10]
------------------------------------------------------------------------------------

References

1 Copine5 expression predicts prognosis following curative resection of esophageal squamous cell carcinoma.Oncol Rep. 2018 Dec;40(6):3772-3780. doi: 10.3892/or.2018.6742. Epub 2018 Sep 27.
2 Genetic variants in the CPNE5 gene are associated with alcohol dependence and obesity in Caucasian populations.J Psychiatr Res. 2015 Dec;71:1-7. doi: 10.1016/j.jpsychires.2015.09.008. Epub 2015 Sep 14.
3 Association analysis identifies 65 new breast cancer risk loci.Nature. 2017 Nov 2;551(7678):92-94. doi: 10.1038/nature24284. Epub 2017 Oct 23.
4 Genetics of heart rate in heart failure patients (GenHRate).Hum Genomics. 2019 May 21;13(1):22. doi: 10.1186/s40246-019-0206-6.
5 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
6 Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
7 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
8 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
9 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
10 Toxicogenomics of kojic acid on gene expression profiling of a375 human malignant melanoma cells. Biol Pharm Bull. 2006 Apr;29(4):655-69.