Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUA175T)

• DOT Name: Protein CDV3 homolog (CDV3)
• Gene Name: CDV3
• Related Disease: Colorectal carcinoma
• UniProt ID: CDV3_HUMAN
• Pfam ID: PF15359
• Sequence:
  MAETEERSLDNFFAKRDKKKKKERSNRAASAAGAAGSAGGSSGAAGAAGGGAGAGTRPGD
  GGTASAGAAGPGAATKAVTKDEDEWKELEQKEVDYSGLRVQAMQISSEKEEDDNEKRQDP
  GDNWEEGGGGGGGMEKSSGPWNKTAPVQAPPAPVIVTETPEPAMTSGVYRPPGARLTTTR
  KTPQGPPEIYSDTQFPSLQSTAKHVESRKDKEMEKSFEVVRHKNRGRDEVSKNQALKLQL
  DNQYAVLENQKSSHSQYN
• Tissue Specificity: Expression levels correlate with those of HER-2/neu in breast cancer cells.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Colorectal carcinoma	DIS5PYL0	Disputed	Genetic Variation	[1]

17 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of Protein CDV3 homolog (CDV3).	[2]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Protein CDV3 homolog (CDV3).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Protein CDV3 homolog (CDV3).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Protein CDV3 homolog (CDV3).	[5]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Protein CDV3 homolog (CDV3).	[6]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Protein CDV3 homolog (CDV3).	[7]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Protein CDV3 homolog (CDV3).	[8]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Protein CDV3 homolog (CDV3).	[9]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Protein CDV3 homolog (CDV3).	[10]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Protein CDV3 homolog (CDV3).	[11]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Protein CDV3 homolog (CDV3).	[12]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Protein CDV3 homolog (CDV3).	[13]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Protein CDV3 homolog (CDV3).	[15]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Protein CDV3 homolog (CDV3).	[17]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Protein CDV3 homolog (CDV3).	[18]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Protein CDV3 homolog (CDV3).	[19]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Protein CDV3 homolog (CDV3).	[8]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Protein CDV3 homolog (CDV3).	[14]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the phosphorylation of Protein CDV3 homolog (CDV3).	[16]

References

• [1] A two-phase case-control study for colorectal cancer genetic susceptibility: candidate genes from chromosomal regions 9q22 and 3q22.Br J Cancer. 2011 Sep 6;105(6):870-5. doi: 10.1038/bjc.2011.296. Epub 2011 Aug 2.
• [2] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [3] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [4] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [5] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [6] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [7] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [8] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [9] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [10] An approach to elucidate potential mechanism of renal toxicity of arsenic trioxide. Exp Hematol. 2007 Feb;35(2):252-62.
• [11] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [12] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [13] Cannabidiol Activates Neuronal Precursor Genes in Human Gingival Mesenchymal Stromal Cells. J Cell Biochem. 2017 Jun;118(6):1531-1546. doi: 10.1002/jcb.25815. Epub 2016 Dec 29.
• [14] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [15] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [16] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [17] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [18] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [19] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.