Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUI0WOO)

DOT Name Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B (ANKRD44)
Synonyms PP6-ARS-B; Serine/threonine-protein phosphatase 6 regulatory subunit ARS-B; Ankyrin repeat domain-containing protein 44
Gene Name ANKRD44
Related Disease
Breast cancer ( )
Breast carcinoma ( )
Abdominal aortic aneurysm ( )
Prostate cancer ( )
Systemic lupus erythematosus ( )
UniProt ID
ANR44_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00023 ; PF12796 ; PF13637
Sequence
MAVLKLTDQPPLVQAIFSGDPEEIRMLIHKTEDVNTLDSEKRTPLHVAAFLGDAEIIELL
ILSGARVNAKDNMWLTPLHRAVASRSEEAVQVLIKHSADVNARDKNWQTPLHVAAANKAV
KCAEVIIPLLSSVNVSDRGGRTALHHAALNGHVEMVNLLLAKGANINAFDKKDRRALHWA
AYMGHLDVVALLINHGAEVTCKDKKGYTPLHAAASNGQINVVKHLLNLGVEIDEINVYGN
TALHIACYNGQDAVVNELIDYGANVNQPNNNGFTPLHFAAASTHGALCLELLVNNGADVN
IQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCVDKDGNTPLHVAARYGHELLINTLIT
SGADTAKCGIHSMFPLHLAALNAHSDCCRKLLSSGFEIDTPDKFGRTCLHAAAAGGNVEC
IKLLQSSGADFHKKDKCGRTPLHYAAANCHFHCIETLVTTGANVNETDDWGRTALHYAAA
SDMDRNKTILGNAHDNSEELERARELKEKEATLCLEFLLQNDANPSIRDKEGYNSIHYAA
AYGHRQCLELLLERTNSGFEESDSGATKSPLHLAAYNGHHQALEVLLQSLVDLDIRDEKG
RTALDLAAFKGHTECVEALINQGASIFVKDNVTKRTPLHASVINGHTLCLRLLLEIADNP
EAVDVKDAKGQTPLMLAVAYGHIDAVSLLLEKEANVDTVDILGCTALHRGIMTGHEECVQ
MLLEQEVSILCKDSRGRTPLHYAAARGHATWLSELLQMALSEEDCCFKDNQGYTPLHWAC
YNGNENCIEVLLEQKCFRKFIGNPFTPLHCAIINDHGNCASLLLGAIDSSIVSCRDDKGR
TPLHAAAFADHVECLQLLLRHSAPVNAVDNSGKTALMMAAENGQAGAVDILVNSAQADLT
VKDKDLNTPLHLACSKGHEKCALLILDKIQDESLINEKNNALQTPLHVAARNGLKVVVEE
LLAKGACVLAVDENASRSNGPRSTPGTAVQKEE
Function Putative regulatory subunit of protein phosphatase 6 (PP6) that may be involved in the recognition of phosphoprotein substrates.

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Breast cancer DIS7DPX1 Definitive Genetic Variation [1]
Breast carcinoma DIS2UE88 Definitive Genetic Variation [1]
Abdominal aortic aneurysm DISD06OF Strong Genetic Variation [2]
Prostate cancer DISF190Y Strong Genetic Variation [3]
Systemic lupus erythematosus DISI1SZ7 Limited Genetic Variation [4]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
12 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B (ANKRD44). [5]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B (ANKRD44). [6]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B (ANKRD44). [7]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B (ANKRD44). [8]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide increases the expression of Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B (ANKRD44). [9]
Testosterone DM7HUNW Approved Testosterone increases the expression of Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B (ANKRD44). [10]
Methotrexate DM2TEOL Approved Methotrexate decreases the expression of Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B (ANKRD44). [11]
SNDX-275 DMH7W9X Phase 3 SNDX-275 decreases the expression of Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B (ANKRD44). [12]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B (ANKRD44). [13]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B (ANKRD44). [14]
PMID28870136-Compound-48 DMPIM9L Patented PMID28870136-Compound-48 increases the expression of Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B (ANKRD44). [9]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B (ANKRD44). [16]
------------------------------------------------------------------------------------
⏷ Show the Full List of 12 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Bisphenol A DM2ZLD7 Investigative Bisphenol A affects the methylation of Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B (ANKRD44). [15]
------------------------------------------------------------------------------------

References

1 ANKRD44 Gene Silencing: A Putative Role in Trastuzumab Resistance in Her2-Like Breast Cancer.Front Oncol. 2019 Jun 26;9:547. doi: 10.3389/fonc.2019.00547. eCollection 2019.
2 Shared Genetic Risk Factors of Intracranial, Abdominal, and Thoracic Aneurysms.J Am Heart Assoc. 2016 Jul 14;5(7):e002603. doi: 10.1161/JAHA.115.002603.
3 Evaluating genetic risk for prostate cancer among Japanese and Latinos.Cancer Epidemiol Biomarkers Prev. 2012 Nov;21(11):2048-58. doi: 10.1158/1055-9965.EPI-12-0598. Epub 2012 Aug 24.
4 Genetic analysis of the pathogenic molecular sub-phenotype interferon-alpha identifies multiple novel loci involved in systemic lupus erythematosus.Genes Immun. 2015 Jan-Feb;16(1):15-23. doi: 10.1038/gene.2014.57. Epub 2014 Oct 23.
5 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
6 Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
7 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
8 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
9 Oxidative stress modulates theophylline effects on steroid responsiveness. Biochem Biophys Res Commun. 2008 Dec 19;377(3):797-802.
10 The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
11 Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
12 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
13 Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
14 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
15 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
16 Cellular reactions to long-term volatile organic compound (VOC) exposures. Sci Rep. 2016 Dec 1;6:37842. doi: 10.1038/srep37842.