Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUXH147)

DOT Name ATP-dependent RNA helicase DDX50 (DDX50)
Synonyms EC 3.6.4.13; DEAD box protein 50; Gu-beta; Nucleolar protein Gu2
Gene Name DDX50
Related Disease
Dengue ( )
UniProt ID
DDX50_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2.00E+29
EC Number
3.6.4.13
Pfam ID
PF00270 ; PF08152 ; PF00271
Sequence
MPGKLLWGDIMELEAPLEESESQKKERQKSDRRKSRHHYDSDEKSETRENGVTDDLDAPK
AKKSKMKEKLNGDTEEGFNRLSDEFSKSHKSRRKDLPNGDIDEYEKKSKRVSSLDTSTHK
SSDNKLEETLTREQKEGAFSNFPISEETIKLLKGRGVTYLFPIQVKTFGPVYEGKDLIAQ
ARTGTGKTFSFAIPLIERLQRNQETIKKSRSPKVLVLAPTRELANQVAKDFKDITRKLSV
ACFYGGTSYQSQINHIRNGIDILVGTPGRIKDHLQSGRLDLSKLRHVVLDEVDQMLDLGF
AEQVEDIIHESYKTDSEDNPQTLLFSATCPQWVYKVAKKYMKSRYEQVDLVGKMTQKAAT
TVEHLAIQCHWSQRPAVIGDVLQVYSGSEGRAIIFCETKKNVTEMAMNPHIKQNAQCLHG
DIAQSQREITLKGFREGSFKVLVATNVAARGLDIPEVDLVIQSSPPQDVESYIHRSGRTG
RAGRTGICICFYQPRERGQLRYVEQKAGITFKRVGVPSTMDLVKSKSMDAIRSLASVSYA
AVDFFRPSAQRLIEEKGAVDALAAALAHISGASSFEPRSLITSDKGFVTMTLESLEEIQD
VSCAWKELNRKLSSNAVSQITRMCLLKGNMGVCFDVPTTESERLQAEWHDSDWILSVPAK
LPEIEEYYDGNTSSNSRQRSGWSSGRSGRSGRSGGRSGGRSGRQSRQGSRSGSRQDGRRR
SGNRNRSRSGGHKRSFD

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Dengue DISKH221 Strong Biomarker [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
14 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of ATP-dependent RNA helicase DDX50 (DDX50). [2]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of ATP-dependent RNA helicase DDX50 (DDX50). [3]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of ATP-dependent RNA helicase DDX50 (DDX50). [4]
Doxorubicin DMVP5YE Approved Doxorubicin increases the expression of ATP-dependent RNA helicase DDX50 (DDX50). [5]
Cisplatin DMRHGI9 Approved Cisplatin affects the expression of ATP-dependent RNA helicase DDX50 (DDX50). [6]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of ATP-dependent RNA helicase DDX50 (DDX50). [7]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide increases the expression of ATP-dependent RNA helicase DDX50 (DDX50). [8]
Testosterone DM7HUNW Approved Testosterone decreases the expression of ATP-dependent RNA helicase DDX50 (DDX50). [9]
Decitabine DMQL8XJ Approved Decitabine affects the expression of ATP-dependent RNA helicase DDX50 (DDX50). [6]
Demecolcine DMCZQGK Approved Demecolcine increases the expression of ATP-dependent RNA helicase DDX50 (DDX50). [10]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of ATP-dependent RNA helicase DDX50 (DDX50). [13]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of ATP-dependent RNA helicase DDX50 (DDX50). [10]
3R14S-OCHRATOXIN A DM2KEW6 Investigative 3R14S-OCHRATOXIN A decreases the expression of ATP-dependent RNA helicase DDX50 (DDX50). [15]
GALLICACID DM6Y3A0 Investigative GALLICACID decreases the expression of ATP-dependent RNA helicase DDX50 (DDX50). [16]
------------------------------------------------------------------------------------
⏷ Show the Full List of 14 Drug(s)
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of ATP-dependent RNA helicase DDX50 (DDX50). [11]
TAK-243 DM4GKV2 Phase 1 TAK-243 increases the sumoylation of ATP-dependent RNA helicase DDX50 (DDX50). [12]
Coumarin DM0N8ZM Investigative Coumarin increases the phosphorylation of ATP-dependent RNA helicase DDX50 (DDX50). [14]
------------------------------------------------------------------------------------

References

1 DDX50 inhibits the replication of dengue virus 2 by upregulating IFN- production.Arch Virol. 2017 Jun;162(6):1487-1494. doi: 10.1007/s00705-017-3250-3. Epub 2017 Feb 8.
2 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
3 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
4 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
5 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
6 Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
7 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
8 Oxidative stress modulates theophylline effects on steroid responsiveness. Biochem Biophys Res Commun. 2008 Dec 19;377(3):797-802.
9 The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
10 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
11 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
12 Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
13 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
14 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
15 Linking site-specific loss of histone acetylation to repression of gene expression by the mycotoxin ochratoxin A. Arch Toxicol. 2018 Feb;92(2):995-1014.
16 Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.