Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUXHJ9H)

DOT Name Age-related maculopathy susceptibility protein 2 (ARMS2)
Gene Name ARMS2
Related Disease
Diabetic retinopathy ( )
Alzheimer disease ( )
Blindness ( )
Cardiovascular disease ( )
Choroidal neovascularization ( )
Glycogen storage disease type II ( )
High blood pressure ( )
Macular degeneration ( )
Neovascular age-related macular degeneration ( )
Basal laminar drusen ( )
Retinal drusen ( )
Severe early-childhood-onset retinal dystrophy ( )
UniProt ID
ARMS2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MLRLYPGPMVTEAEGKGGPEMASLSSSVVPVSFISTLRESVLDPGVGGEGASDKQRSKLS
LSHSMIPAAKIHTELCLPAFFSPAGTQRRFQQPQHHLTLSIIHTAAR
Tissue Specificity Detected in retina and placenta.

Molecular Interaction Atlas (MIA) of This DOT

12 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Diabetic retinopathy DISHGUJM Definitive Biomarker [1]
Alzheimer disease DISF8S70 Strong Genetic Variation [2]
Blindness DISTIM10 Strong Genetic Variation [3]
Cardiovascular disease DIS2IQDX Strong Genetic Variation [4]
Choroidal neovascularization DISLGVL7 Strong Genetic Variation [5]
Glycogen storage disease type II DISXZPBC Strong Genetic Variation [6]
High blood pressure DISY2OHH Strong Genetic Variation [7]
Macular degeneration DISLKKHD Strong Genetic Variation [8]
Neovascular age-related macular degeneration DIS5S9R7 Strong Genetic Variation [9]
Basal laminar drusen DISXZO3H Limited Genetic Variation [10]
Retinal drusen DIS04BI1 Limited Biomarker [11]
Severe early-childhood-onset retinal dystrophy DISFDRFO Limited Genetic Variation [12]
------------------------------------------------------------------------------------
⏷ Show the Full List of 12 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Age-related maculopathy susceptibility protein 2 (ARMS2). [13]
------------------------------------------------------------------------------------

References

1 Association analysis of nine candidate gene polymorphisms in Indian patients with type 2 diabetic retinopathy.BMC Med Genet. 2010 Nov 10;11:158. doi: 10.1186/1471-2350-11-158.
2 Alzheimer's disease and age-related macular degeneration have different genetic models for complement gene variation.Neurobiol Aging. 2012 Aug;33(8):1843.e9-17. doi: 10.1016/j.neurobiolaging.2011.12.036. Epub 2012 Feb 1.
3 Exploring the association of rs10490924 polymorphism with age-related macular degeneration: An in silico approach.J Mol Graph Model. 2018 Mar;80:52-58. doi: 10.1016/j.jmgm.2017.12.023. Epub 2018 Jan 4.
4 Six-Year Incidence and Risk Factors of Age-Related Macular Degeneration in Singaporean Indians: The Singapore Indian Eye Study.Sci Rep. 2018 Jun 11;8(1):8869. doi: 10.1038/s41598-018-27202-w.
5 Myopic choroidal neovascularization genetics.Ophthalmology. 2008 Sep;115(9):1632, 1632.e1. doi: 10.1016/j.ophtha.2008.03.004.
6 Interactions among different genetic loci in age-related macular degeneration.Ophthalmic Genet. 2018 Apr;39(2):189-193. doi: 10.1080/13816810.2017.1393829. Epub 2017 Oct 31.
7 Identifying subtypes of patients with neovascular age-related macular degeneration by genotypic and cardiovascular risk characteristics.BMC Med Genet. 2011 Jun 17;12:83. doi: 10.1186/1471-2350-12-83.
8 C-reactive protein and CFH, ARMS2/HTRA1 gene variants are independently associated with risk of macular degeneration.Ophthalmology. 2010 Aug;117(8):1560-6. doi: 10.1016/j.ophtha.2009.11.020. Epub 2010 Mar 26.
9 Genome-wide association study of neovascular age-related macular degeneration in the Thai population.J Hum Genet. 2017 Nov;62(11):957-962. doi: 10.1038/jhg.2017.72. Epub 2017 Jul 13.
10 Association analysis of genetic and environmental risk factors in the cuticular drusen subtype of age-related macular degeneration.Mol Vis. 2012;18:2271-8. Epub 2012 Aug 18.
11 Genotype-phenotype associations in neovascular age-related macular degeneration.Retina. 2012 Oct;32(9):1950-8. doi: 10.1097/IAE.0b013e31824dadf1.
12 A subgroup of age-related macular degeneration is associated with mono-allelic sequence variants in the ABCA4 gene.Invest Ophthalmol Vis Sci. 2012 Apr 30;53(4):2112-8. doi: 10.1167/iovs.11-8785.
13 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.