Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTVKX1YP)

• DOT Name: Leukemia-associated protein 7 (DLEU7)
• Synonyms: Deleted in lymphocytic leukemia 7
• Gene Name: DLEU7
• Related Disease:
  Acute lymphocytic leukaemia
  Carcinoma
  Cardiovascular disease
  Childhood acute lymphoblastic leukemia
  Ewing sarcoma/peripheral primitive neuroectodermal tumor
  High blood pressure
  Neoplasm
  Non-insulin dependent diabetes
  Small lymphocytic lymphoma
  Lung cancer
  Lung carcinoma
  Retinopathy
  Rheumatoid arthritis
• UniProt ID: LEU7_HUMAN
• Pfam ID: PF15760
• Sequence:
  MASPAPLVASISHQMVALQTLQLLQQEWGWGDGPVAPGNPRDPDHVSTAPARRSGPPRAR
  PGPGREERGGGVGTRSRRTAARANSPEEEVVRGAEGGAELLPFPRDRGPCTLAQMAMRSA
  LARVVDSTSELVSVEQTLLGPLQQERSFPIHLKDSVEFRNICSHLALQIEGQQFDRDLNA
  AHQCLKTIVKKLIQSLANFPSDAHMVACASLRQILQNLPDI
• Tissue Specificity: Ubiquitous.

Molecular Interaction Atlas (MIA) of This DOT

13 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Acute lymphocytic leukaemia	DISPX75S	Strong	Altered Expression	[1]
Carcinoma	DISH9F1N	Strong	Genetic Variation	[2]
Cardiovascular disease	DIS2IQDX	Strong	Genetic Variation	[3]
Childhood acute lymphoblastic leukemia	DISJ5D6U	Strong	Altered Expression	[1]
Ewing sarcoma/peripheral primitive neuroectodermal tumor	DISD4VQC	Strong	Biomarker	[4]
High blood pressure	DISY2OHH	Strong	Genetic Variation	[5]
Neoplasm	DISZKGEW	Strong	Biomarker	[6]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Genetic Variation	[7]
Small lymphocytic lymphoma	DIS30POX	Strong	Biomarker	[8]
Lung cancer	DISCM4YA	moderate	Altered Expression	[8]
Lung carcinoma	DISTR26C	moderate	Altered Expression	[8]
Retinopathy	DISB4B0F	Limited	Genetic Variation	[9]
Rheumatoid arthritis	DISTSB4J	Limited	Biomarker	[10]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Leukemia-associated protein 7 (DLEU7).	[11]

References

• [1] T-cell acute lymphoblastic leukemia with natural killer cell phenotype.Am J Hematol. 1986 Aug;22(4):355-64. doi: 10.1002/ajh.2830220404.
• [2] Neuroendocrine marker expression in thyroid epithelial tumors.Endocr Pathol. 2001 Fall;12(3):291-9. doi: 10.1385/ep:12:3:291.
• [3] Leveraging Polygenic Functional Enrichment to Improve GWAS Power.Am J Hum Genet. 2019 Jan 3;104(1):65-75. doi: 10.1016/j.ajhg.2018.11.008. Epub 2018 Dec 27.
• [4] Relation of neurological marker expression and EWS gene fusion types in MIC2/CD99-positive tumors of the Ewing family.Hum Pathol. 1999 Sep;30(9):1058-64. doi: 10.1016/s0046-8177(99)90223-x.
• [5] Neuropeptide Y signal peptide Pro7 substitution protects against coronary artery atherosclerosis: the Helsinki Sudden Death Study.Atherosclerosis. 2008 Aug;199(2):445-50. doi: 10.1016/j.atherosclerosis.2007.10.021. Epub 2007 Dec 4.
• [6] Schwannoma-like tumor in the anterior cranial fossa immunonegative for Leu7 but immunopositive for Schwann/2E.Neuropathology. 2017 Jun;37(3):265-271. doi: 10.1111/neup.12357. Epub 2016 Dec 7.
• [7] Genome-wide association analyses identify 143 risk variants and putative regulatory mechanisms for type 2 diabetes.Nat Commun. 2018 Jul 27;9(1):2941. doi: 10.1038/s41467-018-04951-w.
• [8] 13q14 deletions in CLL involve cooperating tumor suppressors.Blood. 2010 May 13;115(19):3916-22. doi: 10.1182/blood-2009-10-249367. Epub 2010 Jan 13.
• [9] Leucine 7 to proline 7 polymorphism in the neuropeptide y gene is associated with retinopathy in type 2 diabetes.Exp Clin Endocrinol Diabetes. 2000;108(3):235-6. doi: 10.1055/s-2000-7748.
• [10] Phenotypic and genotypic analysis of mononuclear cells from patients with Felty's syndrome.Ann Rheum Dis. 1990 Feb;49(2):103-6. doi: 10.1136/ard.49.2.103.
• [11] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.