Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTWA4YSR)

• DOT Name: TM2 domain-containing protein 1 (TM2D1)
• Synonyms: Amyloid-beta-binding protein; hBBP
• Gene Name: TM2D1
• Related Disease: Osteomyelitis
• UniProt ID: TM2D1_HUMAN
• Pfam ID: PF05154
• Sequence:
  MAAAWPSGPSAPEAVTARLVGVLWFVSVTTGPWGAVATSAGGEESLKCEDLKVGQYICKD
  PKINDATQEPVNCTNYTAHVSCFPAPNITCKDSSGNETHFTGNEVGFFKPISCRNVNGYS
  YKVAVALSLFLGWLGADRFYLGYPALGLLKFCTVGFCGIGSLIDFILISMQIVGPSDGSS
  YIIDYYGTRLTRLSITNETFRKTQLYP
• Function: May participate in amyloid-beta-induced apoptosis via its interaction with beta-APP42.
• Tissue Specificity: Widely expressed.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Osteomyelitis	DIS0VUZL	Limited	Biomarker	[1]

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of TM2 domain-containing protein 1 (TM2D1).	[2]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of TM2 domain-containing protein 1 (TM2D1).	[3]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of TM2 domain-containing protein 1 (TM2D1).	[3]
Selenium	DM25CGV	Approved	Selenium decreases the expression of TM2 domain-containing protein 1 (TM2D1).	[5]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol decreases the expression of TM2 domain-containing protein 1 (TM2D1).	[6]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of TM2 domain-containing protein 1 (TM2D1).	[7]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of TM2 domain-containing protein 1 (TM2D1).	[4]

References

• [1] A bone sialoprotein-binding protein from Staphylococcus aureus: a member of the staphylococcal Sdr family.Biochem J. 2000 Feb 1;345 Pt 3(Pt 3):611-9.
• [2] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [3] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [4] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [5] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [6] Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
• [7] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.