Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXEFI4O)

DOT Name	Dynein regulatory complex protein 8 (EFCAB2)
Synonyms	EF-hand calcium-binding domain-containing protein 2
Gene Name	EFCAB2
Related Disease	Colon cancer ( ) Colorectal adenocarcinoma ( ) Colorectal cancer ( ) Colorectal cancer, susceptibility to, 1 ( ) Colorectal cancer, susceptibility to, 10 ( ) Colorectal cancer, susceptibility to, 12 ( ) Colorectal carcinoma ( ) Colorectal neoplasm ( ) Temporal lobe epilepsy ( )
UniProt ID	DRC8_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	8J07
Sequence	MLGPGQVRLRPRVWRDKAGGRVADGASGLPPARGSWRETGTGRALGASSPPRPAQGSSSP GIQSGPSSRPGSPRGAEQAGTPRPRLSLGISQATGSAARWRTRRTGKGLGYNSDEIRPRT LLIEHLMEGGRRDHHTMTVLWGTQEIIVAEFHKKIKEAFEVFDHESNNTVDVREIGTIIR SLGCCPTEGELHDLIAEVEEEEPTGYIRFEKFLPVMTEILLERKYRPIPEDVLLRAFEVL DSAKRGFLTKDELIKYMTEEDGVSLRRPG
Function	Component of the nexin-dynein regulatory complex (N-DRC), a key regulator of ciliary/flagellar motility which maintains the alignment and integrity of the distal axoneme and regulates microtubule sliding in motile axonemes.

Molecular Interaction Atlas (MIA) of This DOT

9 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Colon cancer	DISVC52G	Strong	Genetic Variation	[1]
Colorectal adenocarcinoma	DISPQOUB	Strong	Genetic Variation	[1]
Colorectal cancer	DISNH7P9	Strong	Genetic Variation	[1]
Colorectal cancer, susceptibility to, 1	DISZ794C	Strong	Genetic Variation	[1]
Colorectal cancer, susceptibility to, 10	DISQXMYM	Strong	Genetic Variation	[1]
Colorectal cancer, susceptibility to, 12	DIS4FXJX	Strong	Genetic Variation	[1]
Colorectal carcinoma	DIS5PYL0	Strong	Genetic Variation	[1]
Colorectal neoplasm	DISR1UCN	Strong	Genetic Variation	[1]
Temporal lobe epilepsy	DISNOPXX	Limited	Biomarker	[2]
------------------------------------------------------------------------------------


⏷ Show the Full List of 9 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Dynein regulatory complex protein 8 (EFCAB2).	[3]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Dynein regulatory complex protein 8 (EFCAB2).	[4]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Dynein regulatory complex protein 8 (EFCAB2).	[5]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Dynein regulatory complex protein 8 (EFCAB2).	[6]
Belinostat	DM6OC53	Phase 2	Belinostat decreases the expression of Dynein regulatory complex protein 8 (EFCAB2).	[8]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Dynein regulatory complex protein 8 (EFCAB2).	[4]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Dynein regulatory complex protein 8 (EFCAB2).	[9]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde decreases the expression of Dynein regulatory complex protein 8 (EFCAB2).	[10]
------------------------------------------------------------------------------------


⏷ Show the Full List of 8 Drug(s)

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Dynein regulatory complex protein 8 (EFCAB2).	[7]
------------------------------------------------------------------------------------

References

1	Large-Scale Genome-Wide Association Study of East Asians Identifies Loci Associated With Risk for Colorectal Cancer.Gastroenterology. 2019 Apr;156(5):1455-1466. doi: 10.1053/j.gastro.2018.11.066. Epub 2018 Dec 6.
2	High-Throughput Data of Circular RNA Profiles in Human Temporal Cortex Tissue Reveals Novel Insights into Temporal Lobe Epilepsy.Cell Physiol Biochem. 2018;45(2):677-691. doi: 10.1159/000487161. Epub 2018 Jan 31.
3	Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
4	Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
5	Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
6	Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
7	Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
8	Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
9	Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
10	Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.