Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXFDXKJ)

• DOT Name: Uncharacterized protein C1orf54 (C1ORF54)
• Gene Name: C1ORF54
• UniProt ID: CA054_HUMAN
• Pfam ID: PF15465
• Sequence:
  MDVLFVAIFAVPLILGQEYEDEERLGEDEYYQVVYYYTVTPSYDDFSADFTIDYSIFESE
  DRLNRLDKDITEAIETTISLETARADHPKPVTVKPVTTEPSPDLNDAVSSLRSPIPLLLS
  CAFVQVGMYFM

Molecular Interaction Atlas (MIA) of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Uncharacterized protein C1orf54 (C1ORF54).	[1]

12 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Uncharacterized protein C1orf54 (C1ORF54).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Uncharacterized protein C1orf54 (C1ORF54).	[3]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Uncharacterized protein C1orf54 (C1ORF54).	[4]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Uncharacterized protein C1orf54 (C1ORF54).	[5]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Uncharacterized protein C1orf54 (C1ORF54).	[6]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Uncharacterized protein C1orf54 (C1ORF54).	[5]
Selenium	DM25CGV	Approved	Selenium decreases the expression of Uncharacterized protein C1orf54 (C1ORF54).	[7]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of Uncharacterized protein C1orf54 (C1ORF54).	[8]
Pioglitazone	DMKJ485	Approved	Pioglitazone decreases the expression of Uncharacterized protein C1orf54 (C1ORF54).	[9]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Uncharacterized protein C1orf54 (C1ORF54).	[10]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Uncharacterized protein C1orf54 (C1ORF54).	[11]
KOJIC ACID	DMP84CS	Investigative	KOJIC ACID increases the expression of Uncharacterized protein C1orf54 (C1ORF54).	[12]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [4] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [5] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [6] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [7] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [8] Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
• [9] Peroxisome proliferator activated receptor gamma (PPAR-gama) ligand pioglitazone regulated gene networks in term human primary trophoblast cells. Reprod Toxicol. 2018 Oct;81:99-107.
• [10] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [11] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [12] Toxicogenomics of kojic acid on gene expression profiling of a375 human malignant melanoma cells. Biol Pharm Bull. 2006 Apr;29(4):655-69.