Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXSBR60)

• DOT Name: Arginine vasopressin-induced protein 1 (AVPI1)
• Synonyms: AVP-induced protein 1
• Gene Name: AVPI1
• Related Disease:
  Lung cancer
  Lung neoplasm
• UniProt ID: AVPI1_HUMAN
• Pfam ID: PF15063
• Sequence:
  MGTPASVVSEPPPWQAPIEARGRKQASANIFQDAELLQIQALFQRSGDQLAEERAQIIWE
  CAGDHRVAEALKRLRRKRPPRQKPLGHSLHHCSRLRILEPHSALANPQSATETASSEQYL
  HSRKKSARIRRNWRKSGPTSYLHQIRH
• Function: May be involved in MAP kinase activation, epithelial sodium channel (ENaC) down-regulation and cell cycling.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Lung cancer	DISCM4YA	Strong	Biomarker	[1]
Lung neoplasm	DISVARNB	Strong	Biomarker	[1]

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Etoposide	DMNH3PG	Approved	Arginine vasopressin-induced protein 1 (AVPI1) affects the response to substance of Etoposide.	[16]
Mitomycin	DMH0ZJE	Approved	Arginine vasopressin-induced protein 1 (AVPI1) affects the response to substance of Mitomycin.	[16]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Arginine vasopressin-induced protein 1 (AVPI1).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Arginine vasopressin-induced protein 1 (AVPI1).	[13]

12 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Arginine vasopressin-induced protein 1 (AVPI1).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Arginine vasopressin-induced protein 1 (AVPI1).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Arginine vasopressin-induced protein 1 (AVPI1).	[5]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Arginine vasopressin-induced protein 1 (AVPI1).	[6]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Arginine vasopressin-induced protein 1 (AVPI1).	[7]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Arginine vasopressin-induced protein 1 (AVPI1).	[8]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Arginine vasopressin-induced protein 1 (AVPI1).	[9]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Arginine vasopressin-induced protein 1 (AVPI1).	[10]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Arginine vasopressin-induced protein 1 (AVPI1).	[11]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Arginine vasopressin-induced protein 1 (AVPI1).	[12]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Arginine vasopressin-induced protein 1 (AVPI1).	[14]
chloropicrin	DMSGBQA	Investigative	chloropicrin affects the expression of Arginine vasopressin-induced protein 1 (AVPI1).	[15]

References

• [1] Bronchial airway gene expression signatures in mouse lung squamous cell carcinoma and their modulation by cancer chemopreventive agents.Oncotarget. 2017 Mar 21;8(12):18885-18900. doi: 10.18632/oncotarget.13806.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [4] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [5] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [6] The thioxotriazole copper(II) complex A0 induces endoplasmic reticulum stress and paraptotic death in human cancer cells. J Biol Chem. 2009 Sep 4;284(36):24306-19.
• [7] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [8] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [9] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [10] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [11] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [12] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [13] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [14] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [15] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [16] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.