Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTYORAJC)

• DOT Name: Beta-microseminoprotein (MSMB)
• Synonyms: Immunoglobulin-binding factor; IGBF; PN44; Prostate secreted seminal plasma protein; Prostate secretory protein of 94 amino acids; PSP-94; PSP94; Seminal plasma beta-inhibin
• Gene Name: MSMB
• UniProt ID: MSMB_HUMAN
• PDB ID: 2IZ3; 3IX0
• Pfam ID: PF05825
• Sequence:
  MNVLLGSVVIFATFVTLCNASCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETC
  TCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII
• Tissue Specificity: Strongly expressed in prostate, liver, kidney, breast and penis. Also expressed in pancreas, esophagus, stomach, deodenum, colon, trachea, lung, salivary glands and fallopian tube. PSP94 is expressed in lung and breast, whereas PSP57 is found in kidney and bladder.

Molecular Interaction Atlas (MIA) of This DOT

16 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Beta-microseminoprotein (MSMB).	[1]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Beta-microseminoprotein (MSMB).	[2]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Beta-microseminoprotein (MSMB).	[3]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Beta-microseminoprotein (MSMB).	[3]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Beta-microseminoprotein (MSMB).	[4]
Folic acid	DMEMBJC	Approved	Folic acid increases the expression of Beta-microseminoprotein (MSMB).	[5]
Isotretinoin	DM4QTBN	Approved	Isotretinoin increases the expression of Beta-microseminoprotein (MSMB).	[6]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol increases the expression of Beta-microseminoprotein (MSMB).	[7]
Bicalutamide	DMZMSPF	Approved	Bicalutamide decreases the expression of Beta-microseminoprotein (MSMB).	[8]
Enzalutamide	DMGL19D	Approved	Enzalutamide decreases the expression of Beta-microseminoprotein (MSMB).	[8]
Hydroxyflutamide	DMGIZF5	Approved	Hydroxyflutamide decreases the expression of Beta-microseminoprotein (MSMB).	[9]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Beta-microseminoprotein (MSMB).	[10]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Beta-microseminoprotein (MSMB).	[7]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Beta-microseminoprotein (MSMB).	[11]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Beta-microseminoprotein (MSMB).	[13]
1,2-dibromo-4-(1,2-dibromoethyl)cyclohexane	DMDJYHK	Investigative	1,2-dibromo-4-(1,2-dibromoethyl)cyclohexane increases the expression of Beta-microseminoprotein (MSMB).	[14]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Beta-microseminoprotein (MSMB).	[12]

References

• [1] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [2] Persistent and non-persistent changes in gene expression result from long-term estrogen exposure of MCF-7 breast cancer cells. J Steroid Biochem Mol Biol. 2011 Feb;123(3-5):140-50.
• [3] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [4] Genistein disrupts glucocorticoid receptor signaling in human uterine endometrial Ishikawa cells. Environ Health Perspect. 2015 Jan;123(1):80-7. doi: 10.1289/ehp.1408437. Epub 2014 Aug 19.
• [5] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [6] Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
• [7] Gene expression profiling in Ishikawa cells: a fingerprint for estrogen active compounds. Toxicol Appl Pharmacol. 2009 Apr 1;236(1):85-96.
• [8] In silico and in vitro assessment of androgen receptor antagonists. Comput Biol Chem. 2021 Jun;92:107490. doi: 10.1016/j.compbiolchem.2021.107490. Epub 2021 Apr 23.
• [9] Androgen receptor modulation following combination exposure to brominated flame-retardants. Sci Rep. 2018 Mar 19;8(1):4843. doi: 10.1038/s41598-018-23181-0.
• [10] Identification of a group of brominated flame retardants as novel androgen receptor antagonists and potential neuronal and endocrine disrupters. Environ Int. 2015 Jan;74:60-70.
• [11] Inter- and intra-laboratory study to determine the reproducibility of toxicogenomics datasets. Toxicology. 2011 Nov 28;290(1):50-8.
• [12] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [13] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [14] TBECH, 1,2-dibromo-4-(1,2 dibromoethyl) cyclohexane, alters androgen receptor regulation in response to mutations associated with prostate cancer. Toxicol Appl Pharmacol. 2016 Sep 15;307:91-101. doi: 10.1016/j.taap.2016.07.018. Epub 2016 Jul 27.