Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTYZL88Z)

• DOT Name: Small glutamine-rich tetratricopeptide repeat-containing protein beta (SGTB)
• Synonyms: Beta-SGT; Small glutamine-rich protein with tetratricopeptide repeats 2
• Gene Name: SGTB
• UniProt ID: SGTB_HUMAN
• Pfam ID: PF16546 ; PF00515 ; PF13414
• Sequence:
  MSSIKHLVYAVIRFLREQSQMDTYTSDEQESLEVAIQCLETVFKISPEDTHLAVSQPLTE
  MFTSSFCKNDVLPLSNSVPEDVGKADQLKDEGNNHMKEENYAAAVDCYTQAIELDPNNAV
  YYCNRAAAQSKLGHYTDAIKDCEKAIAIDSKYSKAYGRMGLALTALNKFEEAVTSYQKAL
  DLDPENDSYKSNLKIAEQKLREVSSPTGTGLSFDMASLINNPAFISMAASLMQNPQVQQL
  MSGMMTNAIGGPAAGVGGLTDLSSLIQAGQQFAQQIQQQNPELIEQLRNHIRSRSFSSSA
  EEHS
• Function: Co-chaperone that binds directly to HSC70 and HSP70 and regulates their ATPase activity.

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Small glutamine-rich tetratricopeptide repeat-containing protein beta (SGTB).	[1]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Small glutamine-rich tetratricopeptide repeat-containing protein beta (SGTB).	[13]

14 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Small glutamine-rich tetratricopeptide repeat-containing protein beta (SGTB).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Small glutamine-rich tetratricopeptide repeat-containing protein beta (SGTB).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Small glutamine-rich tetratricopeptide repeat-containing protein beta (SGTB).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Small glutamine-rich tetratricopeptide repeat-containing protein beta (SGTB).	[5]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Small glutamine-rich tetratricopeptide repeat-containing protein beta (SGTB).	[6]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Small glutamine-rich tetratricopeptide repeat-containing protein beta (SGTB).	[7]
Marinol	DM70IK5	Approved	Marinol increases the expression of Small glutamine-rich tetratricopeptide repeat-containing protein beta (SGTB).	[8]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Small glutamine-rich tetratricopeptide repeat-containing protein beta (SGTB).	[9]
Camptothecin	DM6CHNJ	Phase 3	Camptothecin decreases the expression of Small glutamine-rich tetratricopeptide repeat-containing protein beta (SGTB).	[10]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Small glutamine-rich tetratricopeptide repeat-containing protein beta (SGTB).	[11]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Small glutamine-rich tetratricopeptide repeat-containing protein beta (SGTB).	[12]
Scriptaid	DM9JZ21	Preclinical	Scriptaid increases the expression of Small glutamine-rich tetratricopeptide repeat-containing protein beta (SGTB).	[10]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Small glutamine-rich tetratricopeptide repeat-containing protein beta (SGTB).	[14]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Small glutamine-rich tetratricopeptide repeat-containing protein beta (SGTB).	[15]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [4] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [5] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [6] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [7] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [8] Delta9-tetrahydrocannabinol inhibits cytotrophoblast cell proliferation and modulates gene transcription. Mol Hum Reprod. 2006 May;12(5):321-33. doi: 10.1093/molehr/gal036. Epub 2006 Apr 5.
• [9] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [10] Development and validation of the TGx-HDACi transcriptomic biomarker to detect histone deacetylase inhibitors in human TK6 cells. Arch Toxicol. 2021 May;95(5):1631-1645. doi: 10.1007/s00204-021-03014-2. Epub 2021 Mar 26.
• [11] New insights into BaP-induced toxicity: role of major metabolites in transcriptomics and contribution to hepatocarcinogenesis. Arch Toxicol. 2016 Jun;90(6):1449-58.
• [12] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [13] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [14] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [15] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.