Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZ0QU22)

• DOT Name: Selenoprotein H (SELENOH)
• Synonyms: SelH
• Gene Name: SELENOH
• Related Disease:
  Colorectal carcinoma
  Advanced cancer
  Parkinson disease
  Schizophrenia
  Neural tube defect
• UniProt ID: SELH_HUMAN
• Pfam ID: PF10262
• Sequence:
  MAPRGRKRKAEAAVVAVAEKREKLANGGEGMEEATVVIEHCTSURVYGRNAAALSQALRL
  EAPELPVKVNPTKPRRGSFEVTLLRPDGSSAELWTGIKKGPPRKLKFPEPQEVVEELKKY
  LS
• Function: May be involved in a redox-related process.

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Colorectal carcinoma	DIS5PYL0	Definitive	Biomarker	[1]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[2]
Parkinson disease	DISQVHKL	Strong	Genetic Variation	[3]
Schizophrenia	DISSRV2N	Strong	Genetic Variation	[4]
Neural tube defect	DIS5J95E	Limited	Genetic Variation	[5]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Paraquat	DMR8O3X	Investigative	Selenoprotein H (SELENOH) decreases the response to substance of Paraquat.	[10]

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of Selenoprotein H (SELENOH).	[6]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Selenoprotein H (SELENOH).	[7]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Selenoprotein H (SELENOH).	[8]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Selenoprotein H (SELENOH).	[9]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Selenoprotein H (SELENOH).	[10]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Selenoprotein H (SELENOH).	[11]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Selenoprotein H (SELENOH).	[13]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Selenoprotein H (SELENOH).	[12]

References

• [1] Genetic variation in selenoprotein genes, lifestyle, and risk of colon and rectal cancer.PLoS One. 2012;7(5):e37312. doi: 10.1371/journal.pone.0037312. Epub 2012 May 17.
• [2] Selenoprotein H controls cell cycle progression and proliferation of human colorectal cancer cells.Free Radic Biol Med. 2018 Nov 1;127:98-107. doi: 10.1016/j.freeradbiomed.2018.01.010. Epub 2018 Jan 9.
• [3] The Thioredoxin-Like Family of Selenoproteins: Implications in Aging and Age-Related Degeneration.Biol Trace Elem Res. 2019 Mar;188(1):189-195. doi: 10.1007/s12011-018-1521-9. Epub 2018 Sep 18.
• [4] Genome-Wide Association Study Detected Novel Susceptibility Genes for Schizophrenia and Shared Trans-Populations/Diseases Genetic Effect.Schizophr Bull. 2019 Jun 18;45(4):824-834. doi: 10.1093/schbul/sby140.
• [5] Mini-review: toward understanding mechanisms of genetic neural tube defects in mice.Teratology. 1999 Nov;60(5):292-305. doi: 10.1002/(SICI)1096-9926(199911)60:5<292::AID-TERA10>3.0.CO;2-6.
• [6] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [7] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [8] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [9] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [10] Selenoprotein H suppresses cellular senescence through genome maintenance and redox regulation. J Biol Chem. 2014 Dec 5;289(49):34378-88. doi: 10.1074/jbc.M114.611970. Epub 2014 Oct 21.
• [11] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [12] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [13] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [14] Selenoprotein H suppresses cellular senescence through genome maintenance and redox regulation. J Biol Chem. 2014 Dec 5;289(49):34378-88. doi: 10.1074/jbc.M114.611970. Epub 2014 Oct 21.