Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZ4NA7Q)

• DOT Name: Leukocyte immunoglobulin-like receptor subfamily A member 1 (LILRA1)
• Synonyms: CD85 antigen-like family member I; Leukocyte immunoglobulin-like receptor 6; LIR-6; CD antigen CD85i
• Gene Name: LILRA1
• Related Disease:
  Alcohol dependence
  Major depressive disorder
  Multiple sclerosis
  Nervous system inflammation
  Microscopic polyangiitis
  Rheumatoid arthritis
  Systemic lupus erythematosus
• UniProt ID: LIRA1_HUMAN
• Pfam ID: PF13895 ; PF13927
• Sequence:
  MTPIVTVLICLRLSLGPRTHVQAGTLPKPTLWAEPGSVITQGSPVTLWCQGILETQEYRL
  YREKKTAPWITRIPQEIVKKGQFPIPSITWEHTGRYRCFYGSHTAGWSEPSDPLELVVTG
  AYIKPTLSALPSPVVTSGGNVTLHCVSQVAFGSFILCKEGEDEHPQCLNSQPRTHGWSRA
  IFSVGPVSPSRRWSYRCYAYDSNSPHVWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPGE
  SLTLQCVSDVSYDRFVLYKEGERDFLQLPGPQPQAGLSQANFTLGPVSRSYGGQYRCSGA
  YNLSSEWSAPSDPLDILIAGQFRGRPFISVHPGPTVASGENVTLLCQSWGPFHTFLLTKA
  GAADAPLRLRSIHEYPKYQAEFPMSPVTSAHSGTYRCYGSLSSNPYLLSHPSDSLELMVS
  GAAETLSPPQNKSDSKAGAANTLSPSQNKTASHPQDYTVENLIRMGIAGLVLVVLGILLF
  EAQHSQRSL
• Function: May act as receptor for class I MHC antigens.
• Tissue Specificity: Detected in monocytes and B-cells.
• KEGG Pathway:
  Osteoclast differentiation (hsa04380)
  B cell receptor sig.ling pathway (hsa04662)
• Reactome Pathway: Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell (R-HSA-198933)

Molecular Interaction Atlas (MIA) of This DOT

7 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Alcohol dependence	DIS4ZSCO	Strong	Genetic Variation	[1]
Major depressive disorder	DIS4CL3X	Strong	Genetic Variation	[2]
Multiple sclerosis	DISB2WZI	Strong	Altered Expression	[3]
Nervous system inflammation	DISB3X5A	Strong	Biomarker	[3]
Microscopic polyangiitis	DIS74KSO	Limited	Biomarker	[4]
Rheumatoid arthritis	DISTSB4J	Limited	Biomarker	[4]
Systemic lupus erythematosus	DISI1SZ7	Limited	Biomarker	[4]

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Rosiglitazone	DMILWZR	Approved	Rosiglitazone increases the expression of Leukocyte immunoglobulin-like receptor subfamily A member 1 (LILRA1).	[5]
PMID27336223-Compound-5	DM6E50A	Patented	PMID27336223-Compound-5 increases the expression of Leukocyte immunoglobulin-like receptor subfamily A member 1 (LILRA1).	[5]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Leukocyte immunoglobulin-like receptor subfamily A member 1 (LILRA1).	[6]

References

• [1] Polymorphisms in ABLIM1 are associated with personality traits and alcohol dependence.J Mol Neurosci. 2012 Feb;46(2):265-71. doi: 10.1007/s12031-011-9530-6. Epub 2011 May 6.
• [2] The PHF21B gene is associated with major depression and modulates the stress response.Mol Psychiatry. 2017 Jul;22(7):1015-1025. doi: 10.1038/mp.2016.174. Epub 2016 Oct 25.
• [3] Silencing Leukocyte Immunoglobulin-Like Receptor A1 in Monocytes Inhibits Inflammation in Mice with Multiple Sclerosis.Neuroimmunomodulation. 2019;26(2):93-101. doi: 10.1159/000495625. Epub 2019 Jan 23.
• [4] Association of LILRA2 (ILT1, LIR7) splice site polymorphism with systemic lupus erythematosus and microscopic polyangiitis.Genes Immun. 2008 Apr;9(3):214-23. doi: 10.1038/gene.2008.5. Epub 2008 Feb 14.
• [5] PPARgamma controls CD1d expression by turning on retinoic acid synthesis in developing human dendritic cells. J Exp Med. 2006 Oct 2;203(10):2351-62.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.