Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZN9TZV)

DOT Name Flagellum-associated coiled-coil domain-containing protein 1 (FLACC1)
Synonyms Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 12 protein
Gene Name FLACC1
Related Disease
Melanoma ( )
Breast cancer ( )
Breast neoplasm ( )
Prostate cancer ( )
Prostate carcinoma ( )
Rheumatoid arthritis ( )
Basal cell carcinoma ( )
Basal cell neoplasm ( )
Breast carcinoma ( )
Esophageal squamous cell carcinoma ( )
Neoplasm of esophagus ( )
Squamous cell carcinoma ( )
UniProt ID
FACC1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MYPNPLIYCTCWDPWNLGPRKLIKTPQLPRKNSTGSSKLTPLVPAPKNHNYLQPTKPVVS
PKMKIHSARQEETNKSFYEVINVSPGYQLVRNREQISVTLGDEMFDRKKRWESEIPDKGR
FSRTNIISDLEEQISELTAIIEQMNRDHQSAQKLLSSEMDLRCAEMKQNFENKNRELKEA
HEAELSELENNYKAALKAEKLAAQEKLEEMGKEYKYLKNMFRTYQDSIYDEMEEKWSKQK
AKWKKDEKFERENILLQQKKKMTKKFEMESGEEDKKINESCSAVFENFIQEKEELLKQHQ
SDTLQLEELRKTKEVPWRRDQINRHWHDVLQQLLLMQVMQEELHAQALILESLNTNLYYT
QLELQKEKAIVGNLEKMLQTKFAETEEKYKHTIQILTEENIHLKQKIISKNEEICEGCSG
RLASITVSKDDSDTVQDGSKKGQES

Molecular Interaction Atlas (MIA) of This DOT

12 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Melanoma DIS1RRCY Definitive Genetic Variation [1]
Breast cancer DIS7DPX1 Strong Biomarker [2]
Breast neoplasm DISNGJLM Strong Biomarker [2]
Prostate cancer DISF190Y Strong Genetic Variation [3]
Prostate carcinoma DISMJPLE Strong Genetic Variation [3]
Rheumatoid arthritis DISTSB4J Strong Genetic Variation [4]
Basal cell carcinoma DIS7PYN3 Limited Genetic Variation [5]
Basal cell neoplasm DIS37IXW Limited Genetic Variation [5]
Breast carcinoma DIS2UE88 Limited Biomarker [2]
Esophageal squamous cell carcinoma DIS5N2GV Limited Genetic Variation [6]
Neoplasm of esophagus DISOLKAQ Limited Genetic Variation [7]
Squamous cell carcinoma DISQVIFL Limited Genetic Variation [5]
------------------------------------------------------------------------------------
⏷ Show the Full List of 12 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
4 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Flagellum-associated coiled-coil domain-containing protein 1 (FLACC1). [8]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Flagellum-associated coiled-coil domain-containing protein 1 (FLACC1). [9]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 increases the expression of Flagellum-associated coiled-coil domain-containing protein 1 (FLACC1). [11]
Trichostatin A DM9C8NX Investigative Trichostatin A affects the expression of Flagellum-associated coiled-coil domain-containing protein 1 (FLACC1). [12]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Flagellum-associated coiled-coil domain-containing protein 1 (FLACC1). [10]
------------------------------------------------------------------------------------

References

1 Two-stage genome-wide association study identifies a novel susceptibility locus associated with melanoma.Oncotarget. 2017 Mar 14;8(11):17586-17592. doi: 10.18632/oncotarget.15230.
2 A transcriptome-wide association study of 229,000 women identifies new candidate susceptibility genes for breast cancer.Nat Genet. 2018 Jul;50(7):968-978. doi: 10.1038/s41588-018-0132-x. Epub 2018 Jun 18.
3 Cross-Cancer Genome-Wide Analysis of Lung, Ovary, Breast, Prostate, and Colorectal Cancer Reveals Novel Pleiotropic Associations.Cancer Res. 2016 Sep 1;76(17):5103-14. doi: 10.1158/0008-5472.CAN-15-2980. Epub 2016 Apr 20.
4 Genetic influences on susceptibility to rheumatoid arthritis in African-Americans.Hum Mol Genet. 2019 Mar 1;28(5):858-874. doi: 10.1093/hmg/ddy395.
5 Combined analysis of keratinocyte cancers identifies novel genome-wide loci.Hum Mol Genet. 2019 Sep 15;28(18):3148-3160. doi: 10.1093/hmg/ddz121.
6 Joint analysis of three genome-wide association studies of esophageal squamous cell carcinoma in Chinese populations.Nat Genet. 2014 Sep;46(9):1001-1006. doi: 10.1038/ng.3064. Epub 2014 Aug 17.
7 Genotypic variants at 2q33 and risk of esophageal squamous cell carcinoma in China: a meta-analysis of genome-wide association studies.Hum Mol Genet. 2012 May 1;21(9):2132-41. doi: 10.1093/hmg/dds029. Epub 2012 Feb 8.
8 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
9 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
10 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
11 MCM5 as a target of BET inhibitors in thyroid cancer cells. Endocr Relat Cancer. 2016 Apr;23(4):335-47. doi: 10.1530/ERC-15-0322. Epub 2016 Feb 24.
12 A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.