Details of the Drug

General Information of Drug (ID: DMPUKA7)

Drug Name
Caplacizumab
Indication
Disease Entry ICD 11 Status REF
Thrombotic thrombocytopenic purpura 3B64.14 Approved [1]
Drug Type
Antibody
Sequence
EVQLVESGGGLVQPGGSLRLSCAASGRTFSYNPMGWFRQAPGKGRELVAAISRTGGSTYY
PDSVEGRFTISRDNAKRMVYLQMNSLRAEDTAVYYCAAAGVRAEDGRVRTLPSEYTFWGQ
GTQVTVSSAAAEVQLVESGGGLVQPGGSLRLSCAASGRTFSYNPMGWFRQAPGKGRELVA
AISRTGGSTYYPDSVEGRFTISRDNAKRMVYLQMNSLRAEDTAVYYCAAAGVRAEDGRVR
TLPSEYTFWGQGTQVTVSS
ADMET Property
Absorption AUC
The area under the plot of plasma concentration (AUC) of drug is 7951 mcgh/L [2]
Absorption Cmax
The maximum plasma concentration (Cmax) of drug is 528 mcg/L [2]
Absorption Tmax
The time to maximum plasma concentration (Tmax) is 6-7 h [2]
Bioavailability
The bioavailability of drug is 90% [2]
Half-life
The concentration or amount of drug in body reduced by one-half in 16 - 27 hours []
Metabolism
The drug is metabolized via the degraded in the reticuloendothelial system to small peptides and amino acids [3]
Vd
The volume of distribution (Vd) of drug is 6.33 L [2]
Cross-matching ID
DrugBank ID
DB06081
TTD ID
DUCA08

Molecular Interaction Atlas of This Drug


Drug Therapeutic Target (DTT)
DTT Name DTT ID UniProt ID MOA REF
von Willebrand factor (VWF) TT3SZBT VWF_HUMAN Inhibitor [1]
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This Drug

Molecular Expression Atlas of This Drug

The Studied Disease Thrombotic thrombocytopenic purpura
ICD Disease Classification 3B64.14
Molecule Name Molecule Type Gene Name p-value Fold-Change Z-score
von Willebrand factor (VWF) DTT VWF 2.96E-01 2.47 2.08
Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Disease Different from Caplacizumab (Comorbidity)
DDI Drug Name DDI Drug ID Severity Mechanism Comorbidity REF
Levomilnacipran DMV26S8 Moderate Increased risk of bleeding by the combination of Caplacizumab and Levomilnacipran. Chronic pain [MG30] [4]
Regorafenib DMHSY1I Major Increased risk of bleeding by the combination of Caplacizumab and Regorafenib. Colorectal cancer [2B91] [5]
Intedanib DMSTA36 Moderate Increased risk of bleeding by the combination of Caplacizumab and Intedanib. Colorectal cancer [2B91] [6]
Ardeparin DMYRX8B Major Increased risk of bleeding by the combination of Caplacizumab and Ardeparin. Coronary thrombosis [BA43] [7]
Danaparoid DM6CLBN Major Increased risk of bleeding by the combination of Caplacizumab and Danaparoid. Deep vein thrombosis [BD71] [7]
Rivaroxaban DMQMBZ1 Major Increased risk of bleeding by the combination of Caplacizumab and Rivaroxaban. Deep vein thrombosis [BD71] [7]
Vilazodone DM4LECQ Moderate Increased risk of bleeding by the combination of Caplacizumab and Vilazodone. Depression [6A70-6A7Z] [4]
Vortioxetine DM6F1PU Moderate Increased risk of bleeding by the combination of Caplacizumab and Vortioxetine. Depression [6A70-6A7Z] [4]
Desvenlafaxine DMHD4PE Moderate Increased risk of bleeding by the combination of Caplacizumab and Desvenlafaxine. Depression [6A70-6A7Z] [4]
Apigenin DMI3491 Minor Increased risk of bleeding by the combination of Caplacizumab and Apigenin. Discovery agent [N.A.] [8]
Tazemetostat DMWP1BH Major Increased risk of bleeding by the combination of Caplacizumab and Tazemetostat. Follicular lymphoma [2A80] [7]
Avapritinib DMK2GZX Major Increased risk of bleeding by the combination of Caplacizumab and Avapritinib. Gastrointestinal stromal tumour [2B5B] [5]
Calaspargase pegol DMQZBXI Moderate Increased risk of bleeding by the combination of Caplacizumab and Calaspargase pegol. Malignant haematopoietic neoplasm [2B33] [9]
Acalabrutinib DM7GCVW Major Increased risk of bleeding by the combination of Caplacizumab and Acalabrutinib. Mature B-cell lymphoma [2A85] [10]
Ibrutinib DMHZCPO Major Increased risk of bleeding by the combination of Caplacizumab and Ibrutinib. Mature B-cell lymphoma [2A85] [11]
Ponatinib DMYGJQO Major Increased risk of bleeding by the combination of Caplacizumab and Ponatinib. Mature B-cell lymphoma [2A85] [12]
Panobinostat DM58WKG Major Increased risk of bleeding by the combination of Caplacizumab and Panobinostat. Multiple myeloma [2A83] [7]
Fedratinib DM4ZBK6 Major Increased risk of bleeding by the combination of Caplacizumab and Fedratinib. Myeloproliferative neoplasm [2A20] [7]
Prasugrel DM7MT6E Major Increased risk of bleeding by the combination of Caplacizumab and Prasugrel. Myocardial infarction [BA41-BA43] [7]
Vorapaxar DMA16BR Major Increased risk of bleeding by the combination of Caplacizumab and Vorapaxar. Myocardial infarction [BA41-BA43] [7]
Nepafenac DMYK490 Moderate Increased risk of bleeding by the combination of Caplacizumab and Nepafenac. Osteoarthritis [FA00-FA05] [13]
MK-4827 DMLYGH4 Moderate Increased risk of bleeding by the combination of Caplacizumab and MK-4827. Ovarian cancer [2C73] [5]
Curcumin DMQPH29 Minor Increased risk of bleeding by the combination of Caplacizumab and Curcumin. Solid tumour/cancer [2A00-2F9Z] [14]
Apixaban DM89JLN Major Increased risk of bleeding by the combination of Caplacizumab and Apixaban. Thrombosis [DB61-GB90] [7]
Cangrelor DM8JRH0 Major Increased risk of bleeding by the combination of Caplacizumab and Cangrelor. Thrombosis [DB61-GB90] [7]
Brilinta DMBR01X Major Increased risk of bleeding by the combination of Caplacizumab and Brilinta. Thrombosis [DB61-GB90] [7]
Cabozantinib DMIYDT4 Major Increased risk of bleeding by the combination of Caplacizumab and Cabozantinib. Thyroid cancer [2D10] [15]
Betrixaban DM2C4RF Major Increased risk of bleeding by the combination of Caplacizumab and Betrixaban. Venous thromboembolism [BD72] [7]
⏷ Show the Full List of 28 DDI Information of This Drug

References

1 Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services. 2019
2 Duggan S: Caplacizumab: First Global Approval. Drugs. 2018 Oct;78(15):1639-1642. doi: 10.1007/s40265-018-0989-0.
3 Li K, Xu Y: Citrate metabolism in blood transfusions and its relationship due to metabolic alkalosis and respiratory acidosis. Int J Clin Exp Med. 2015 Apr 15;8(4):6578-84. eCollection 2015.
4 Alderman CP, Moritz CK, Ben-Tovim DI "Abnormal platelet aggregation associated with fluoxetine therapy." Ann Pharmacother 26 (1992): 1517-9. [PMID: 1482806]
5 Cerner Multum, Inc. "UK Summary of Product Characteristics.".
6 Product Information. Ofev (nintedanib). Boehringer Ingelheim, Ridgefield, CT.
7 Cerner Multum, Inc. "Australian Product Information.".
8 Heck AM, DeWitt BA, Lukes AL "Potential interactions between alternative therapies and warfarin." Am J Health Syst Pharm 57 (2000): 1221-7 quiz 1228-30. [PMID: 10902065]
9 Caruso V, Iacoviello L, Di Castelnuovo A, et.al "Thrombotic complications in childhood acute lymphoblastic leukemia: a meta-analysis of 17 prospective studies comprising 1752 pediatric patients." Blood 108 (2006): 2216-22. [PMID: 16804111]
10 Product Information. Calquence (acalabrutinib). Astra-Zeneca Pharmaceuticals, Wilmington, DE.
11 Agencia Espaola de Medicamentos y Productos Sanitarios Healthcare "Centro de informacion online de medicamentos de la AEMPS - CIMA.".
12 Product Information. Iclusig (ponatinib). Ariad Pharmaceuticals Inc, Cambridge, MA.
13 Product Information. Acular (ketorolac). Allergan Inc, Irvine, CA.
14 Abebe W "Herbal medication: potential for adverse interactions with analgesic drugs." J Clin Pharm Ther 27 (2002): 391-401. [PMID: 12472978]
15 Product Information. Cometriq (cabozantinib). Exelixis Inc, S San Francisco, CA.