Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT50QJ3)

DTT Name Influenza Neuraminidase (Influ NA)
Synonyms STNA; NEU1; NANase; N-acylneuraminate glycohydrolase; Influ Sialidase
Gene Name Influ NA
DTT Type
Successful target
 [1]
Related Disease
Influenza [ICD-11: 1E30-1E32]
BioChemical Class
Glycosylase
UniProt ID
NRAM_I33A0
TTD ID
T31595
EC Number
EC 3.2.1.18
Sequence
MNPNQKIITIGSICMVVGIISLILQIGNIISIWISHSIQTGNQNHTGICNQGIITYNVVA
GQDSTSVILTGNSSLCPIRGWAIHSKDNGIRIGSKGDVFVIREPFISCSHLECRTFFLTQ
GALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGIS
GPDNGAVAVLKYNGIITETIKSWRKKILRTQESECTCVNGSCFTIMTDGPSNGLASYKIF
KIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGY
ICSGVFGDNPRPKDGPGSCGPVSADGANGVKGFSYRYGNGVWIGRTKSDSSRHGFEMIWD
PNGWTETDSRFSVRQDVVAMTDRSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPEEETI
WTSGSIISFCGVNSDTVDWSWPDGAELPFTIDK
Function Unlike other strains, A/WSN/33 neuraminidase binds and activates plasminogen into plasmin in the vicinity of HA so that activated plasmin cleaves HA rendering the virus infectious.
KEGG Pathway
( )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTT
3 Approved Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Oseltamivir DMGO72P Influenza virus infection 1E30-1E32 Approved [2], [3]
Peramivir DMNXY5K Influenza virus infection 1E30-1E32 Approved [1], [2]
Zanamivir DMFMBZ4 Influenza virus infection 1E30-1E32 Approved [2], [3]
------------------------------------------------------------------------------------
3 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
CS-8958 DM4CSDH Influenza virus infection 1E30-1E32 Phase 3 [1]
UX-001 DMD2O0L Hereditary inclusion body myositis 4A41.2 Phase 3 [4]
DAS-181 DM0Y8JP Influenza virus infection 1E30-1E32 Phase 2 [5], [6]
------------------------------------------------------------------------------------
2 Discontinued Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
BCX-140 DMBJERO Influenza virus infection 1E30-1E32 Terminated [7], [6], [8]
GS-3435 DMV7JC6 Influenza virus infection 1E30-1E32 Terminated [9], [6]
------------------------------------------------------------------------------------
63 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
(E,E)-1,7-Diphenyl-4,6-heptadien-3-one DMWU17O Discovery agent N.A. Investigative [10]
(E,E)-5-Hydroxy-1,7-diphenyl-4,6-heptadien-3-one DMBIV6M Discovery agent N.A. Investigative [10]
(S)-1,7-Diphenyl-6(E)-hepten-3-ol DM1U7MC Discovery agent N.A. Investigative [10]
2,4-Deoxy-4-Guanidino-5-N-Acetyl-Neuraminic Acid DMZO0EI Discovery agent N.A. Investigative [8]
2-Deoxy-2,3-Dehydro-N-Acetyl-Neuraminic Acid DMIAM5L N. A. N. A. Investigative [4]
4-(Acetylamino)-3-Amino Benzoic Acid DMR37FN Discovery agent N.A. Investigative [4]
4-(ACETYLAMINO)-3-HYDROXY-5-NITROBENZOIC ACID DM8F0N5 Discovery agent N.A. Investigative [11]
4-(ACETYLAMINO)-5-AMINO-3-HYDROXYBENZOIC ACID DM1DKSV Discovery agent N.A. Investigative [11]
4-Amino-2-Deoxy-2,3-Dehydro-N-Neuraminic Acid DMINUHD Discovery agent N.A. Investigative [8]
8-DEOXYGARTANIN DMEOP4J Discovery agent N.A. Investigative [12]
A-192558 DMV03NS Discovery agent N.A. Investigative [13], [14], [15]
A-315675 DMSQLZF Discovery agent N.A. Investigative [13], [14], [15]
Alpha-D-Mannose DMF5DLW Discovery agent N.A. Investigative [4]
Apigenin DMI3491 Discovery agent N.A. Investigative [16]
BCX-1827 DMVOS2C Discovery agent N.A. Investigative [13], [14], [15]
BCX-1898 DM6JB32 Discovery agent N.A. Investigative [13], [14], [15]
BCX-1923 DM8G4HS Discovery agent N.A. Investigative [13], [14], [15]
Beta-D-Mannose DMHIG9K Discovery agent N.A. Investigative [4]
CALOPOCARPIN DMVXKLF Discovery agent N.A. Investigative [17]
Cristacarpin DMYPLZ8 Discovery agent N.A. Investigative [17]
CUDRATRICUSXANTHONE DMBL46A Discovery agent N.A. Investigative [18]
Cudratricusxanthone F DM10BOC Discovery agent N.A. Investigative [18]
Cudraxanthone D DMBQ1VO Discovery agent N.A. Investigative [18]
Cudraxanthone L DMP1D5Q Discovery agent N.A. Investigative [18]
Cudraxanthone M DMIQFAU Discovery agent N.A. Investigative [18]
Cyclopentane amide derivatives 1 DM78PR5 Discovery agent N.A. Investigative [13], [14], [15]
Cyclopentane amide derivatives 2 DMGU97P Discovery agent N.A. Investigative [13], [14], [15]
Cyclopentane amide derivatives 3 DMHTVRL Discovery agent N.A. Investigative [13], [14], [15]
Cyclopentane amide derivatives 4 DMOA7EP Discovery agent N.A. Investigative [13], [14], [15]
DEMETHYLMEDICARPIN DMUVR5T Discovery agent N.A. Investigative [17]
ERYSTAGALLIN A DMCHVIG Discovery agent N.A. Investigative [17]
Erysubin D DMVA9F7 Discovery agent N.A. Investigative [17]
Erysubin E DMXWK1A Discovery agent N.A. Investigative [17]
Erythribyssin D DMBVSKZ Discovery agent N.A. Investigative [17]
Erythribyssin L DMUL4AP Discovery agent N.A. Investigative [17]
Erythribyssin M DMWEK8I Discovery agent N.A. Investigative [17]
Erythribyssin O DM8LEJ4 Discovery agent N.A. Investigative [17]
Eryvarin D DM8BS5C Discovery agent N.A. Investigative [17]
FANA DM45K8W Discovery agent N.A. Investigative [13], [14], [15]
Fucose DMAHMSV N. A. N. A. Investigative [4]
Gamma-mangostin DMC0OVP Discovery agent N.A. Investigative [12]
GARCINONE D DMQDV3U Discovery agent N.A. Investigative [12]
GARTANIN DMZ5AD8 Discovery agent N.A. Investigative [12]
GOSSYPETIN DMMT05U Discovery agent N.A. Investigative [16]
GS4071 DMG0OUD Discovery agent N.A. Investigative [13], [14], [15]
HERBACETIN DM8MD52 Discovery agent N.A. Investigative [16]
ISONEORAUTENOL DM69XT3 Discovery agent N.A. Investigative [17]
Kaempferol DMHEMUB Discovery agent N.A. Investigative [16]
KATSUMADAIN A DM513QY Discovery agent N.A. Investigative [10]
Lactose DMM0Z6Y Discovery agent N.A. Investigative [4]
MACLURAXANTHONE DMOMG7S Discovery agent N.A. Investigative [18]
MANGIFERIN DMWAF5Z Discovery agent N.A. Investigative [18]
MANGOSTANIN DMOWZUB Discovery agent N.A. Investigative [12]
MANGOSTANOL DMG3DUE Discovery agent N.A. Investigative [12]
MANGOSTENONE F DMNRZ3S Discovery agent N.A. Investigative [12]
MANGOSTENONE G DM4I2NR Discovery agent N.A. Investigative [12]
MANGOSTIN DMYQGDV Discovery agent N.A. Investigative [12]
NEORAUTENOL DM5GMOJ Discovery agent N.A. Investigative [17]
O-Sialic Acid DMCAR7B Discovery agent N.A. Investigative [11]
PHASEOLIN DM7H5KY Discovery agent N.A. Investigative [17]
PHASEOLLIDIN DMSQ10I Discovery agent N.A. Investigative [17]
RHODIOLININ DMH9QAF Discovery agent N.A. Investigative [16]
SMEATHXANTHONE A DMZC2BT Discovery agent N.A. Investigative [12]
------------------------------------------------------------------------------------
⏷ Show the Full List of 63 Investigative Drug(s)

References

1 Developing new antiviral agents for influenza treatment: what does the future hold Clin Infect Dis. 2009 Jan 1;48 Suppl 1:S3-13.
2 Current and future antiviral therapy of severe seasonal and avian influenza. Antiviral Res. 2008 Apr;78(1):91-102.
3 Antiviral agents for influenza, hepatitis C and herpesvirus, enterovirus and rhinovirus infections. Med J Aust. 2001 Jul 16;175(2):112-6.
4 How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
5 Inhibition of neuraminidase inhibitor-resistant influenza virus by DAS181, a novel sialidase fusion protein. PLoS One. 2009 Nov 6;4(11):e7838.
6 Neuraminidase inhibitors: zanamivir and oseltamivir. Ann Pharmacother. 2001 Jan;35(1):57-70.
7 CN patent application no. 104447481, Benzoic acid thiourea anti-influenza virus compounds as well as preparation method and use thereof.
8 DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-41.
9 US patent application no. 2010,0081,713, Compositions and methods for treating viral infections.
10 Antiviral potential and molecular insight into neuraminidase inhibiting diarylheptanoids from Alpinia katsumadai. J Med Chem. 2010 Jan 28;53(2):778-86.
11 The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
12 Xanthones with neuraminidase inhibitory activity from the seedcases of Garcinia mangostana. Bioorg Med Chem. 2010 Sep 1;18(17):6258-64.
13 Antiviral agents active against influenza A viruses. Nat Rev Drug Discov. 2006 Dec;5(12):1015-25.
14 Comparison of the anti-influenza virus activity of cyclopentane derivatives with oseltamivir and zanamivir in vivo. Bioorg Med Chem. 2005 Jun 2;13(12):4071-7.
15 Syntheses and neuraminidase inhibitory activity of multisubstituted cyclopentane amide derivatives. J Med Chem. 2004 Apr 8;47(8):1919-29.
16 Neuraminidase inhibitory activities of flavonols isolated from Rhodiola rosea roots and their in vitro anti-influenza viral activities. Bioorg Med Chem. 2009 Oct 1;17(19):6816-23.
17 Prenylated pterocarpans as bacterial neuraminidase inhibitors. Bioorg Med Chem. 2010 May 1;18(9):3335-44.
18 Characteristic of neuraminidase inhibitory xanthones from Cudrania tricuspidata. Bioorg Med Chem. 2009 Apr 1;17(7):2744-50.