Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT50QJ3)

DTT Name Influenza Neuraminidase (Influ NA)
Synonyms STNA; NEU1; NANase; N-acylneuraminate glycohydrolase; Influ Sialidase
Gene Name Influ NA
DTT Type
Successful target
 [1]
BioChemical Class
Glycosylase
UniProt ID
NRAM_I33A0
TTD ID
T31595
EC Number
EC 3.2.1.18
Sequence
MNPNQKIITIGSICMVVGIISLILQIGNIISIWISHSIQTGNQNHTGICNQGIITYNVVA
GQDSTSVILTGNSSLCPIRGWAIHSKDNGIRIGSKGDVFVIREPFISCSHLECRTFFLTQ
GALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGIS
GPDNGAVAVLKYNGIITETIKSWRKKILRTQESECTCVNGSCFTIMTDGPSNGLASYKIF
KIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGY
ICSGVFGDNPRPKDGPGSCGPVSADGANGVKGFSYRYGNGVWIGRTKSDSSRHGFEMIWD
PNGWTETDSRFSVRQDVVAMTDRSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPEEETI
WTSGSIISFCGVNSDTVDWSWPDGAELPFTIDK
Function Unlike other strains, A/WSN/33 neuraminidase binds and activates plasminogen into plasmin in the vicinity of HA so that activated plasmin cleaves HA rendering the virus infectious.
KEGG Pathway
Other glycan degradation (stm00511 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTT
3 Approved Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Oseltamivir DMGO72P Influenza 1E30-1E32 Approved [2]
Peramivir DMNXY5K Influenza virus infection 1E30-1E32 Approved [1]
Zanamivir DMFMBZ4 Influenza 1E30-1E32 Approved [2]
------------------------------------------------------------------------------------
4 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
CS-8958 DM4CSDH Influenza virus infection 1E30-1E32 Phase 3 [1]
UX-001 DMD2O0L Hereditary inclusion body myositis 4A41.2 Phase 3 [3]
DAS-181 DM0Y8JP Influenza virus infection 1E30-1E32 Phase 2 [4]
Lactose DMO4GPK Discovery agent N.A. Phase 1 [3]
------------------------------------------------------------------------------------
2 Discontinued Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
BCX-140 DMBJERO Influenza virus infection 1E30-1E32 Terminated [5]
GS-3435 DMV7JC6 Influenza virus infection 1E30-1E32 Terminated [6]
------------------------------------------------------------------------------------
62 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
(E,E)-1,7-Diphenyl-4,6-heptadien-3-one DMWU17O Discovery agent N.A. Investigative [7]
(E,E)-5-Hydroxy-1,7-diphenyl-4,6-heptadien-3-one DMBIV6M Discovery agent N.A. Investigative [7]
(S)-1,7-Diphenyl-6(E)-hepten-3-ol DM1U7MC Discovery agent N.A. Investigative [7]
2,4-Deoxy-4-Guanidino-5-N-Acetyl-Neuraminic Acid DMZO0EI Discovery agent N.A. Investigative [8]
2-Deoxy-2,3-Dehydro-N-Acetyl-Neuraminic Acid DMIAM5L N. A. N. A. Investigative [3]
4-(Acetylamino)-3-Amino Benzoic Acid DMR37FN Discovery agent N.A. Investigative [3]
4-(ACETYLAMINO)-3-HYDROXY-5-NITROBENZOIC ACID DM8F0N5 Discovery agent N.A. Investigative [9]
4-(ACETYLAMINO)-5-AMINO-3-HYDROXYBENZOIC ACID DM1DKSV Discovery agent N.A. Investigative [9]
4-Amino-2-Deoxy-2,3-Dehydro-N-Neuraminic Acid DMINUHD Discovery agent N.A. Investigative [8]
8-DEOXYGARTANIN DMEOP4J Discovery agent N.A. Investigative [10]
A-192558 DMV03NS Discovery agent N.A. Investigative [11]
A-315675 DMSQLZF Discovery agent N.A. Investigative [11]
Alpha-D-Mannose DMF5DLW Discovery agent N.A. Investigative [3]
APIGENIN DMI3491 Discovery agent N.A. Investigative [12]
BCX-1827 DMVOS2C Discovery agent N.A. Investigative [11]
BCX-1898 DM6JB32 Discovery agent N.A. Investigative [11]
BCX-1923 DM8G4HS Discovery agent N.A. Investigative [11]
Beta-D-Mannose DMHIG9K Discovery agent N.A. Investigative [3]
CALOPOCARPIN DMVXKLF Discovery agent N.A. Investigative [13]
Cristacarpin DMYPLZ8 Discovery agent N.A. Investigative [13]
CUDRATRICUSXANTHONE DMBL46A Discovery agent N.A. Investigative [14]
Cudratricusxanthone F DM10BOC Discovery agent N.A. Investigative [14]
Cudraxanthone D DMBQ1VO Discovery agent N.A. Investigative [14]
Cudraxanthone L DMP1D5Q Discovery agent N.A. Investigative [14]
Cudraxanthone M DMIQFAU Discovery agent N.A. Investigative [14]
Cyclopentane amide derivatives 1 DM78PR5 Discovery agent N.A. Investigative [11]
Cyclopentane amide derivatives 2 DMGU97P Discovery agent N.A. Investigative [11]
Cyclopentane amide derivatives 3 DMHTVRL Discovery agent N.A. Investigative [11]
Cyclopentane amide derivatives 4 DMOA7EP Discovery agent N.A. Investigative [11]
DEMETHYLMEDICARPIN DMUVR5T Discovery agent N.A. Investigative [13]
ERYSTAGALLIN A DMCHVIG Discovery agent N.A. Investigative [13]
Erysubin D DMVA9F7 Discovery agent N.A. Investigative [13]
Erysubin E DMXWK1A Discovery agent N.A. Investigative [13]
Erythribyssin D DMBVSKZ Discovery agent N.A. Investigative [13]
Erythribyssin L DMUL4AP Discovery agent N.A. Investigative [13]
Erythribyssin M DMWEK8I Discovery agent N.A. Investigative [13]
Erythribyssin O DM8LEJ4 Discovery agent N.A. Investigative [13]
Eryvarin D DM8BS5C Discovery agent N.A. Investigative [13]
FANA DM45K8W Discovery agent N.A. Investigative [11]
Fucose DMAHMSV N. A. N. A. Investigative [3]
Gamma-mangostin DMC0OVP Discovery agent N.A. Investigative [10]
GARCINONE D DMQDV3U Discovery agent N.A. Investigative [10]
GARTANIN DMZ5AD8 Discovery agent N.A. Investigative [10]
GOSSYPETIN DMMT05U Discovery agent N.A. Investigative [12]
GS4071 DMG0OUD Discovery agent N.A. Investigative [11]
HERBACETIN DM8MD52 Discovery agent N.A. Investigative [12]
ISONEORAUTENOL DM69XT3 Discovery agent N.A. Investigative [13]
KAEMPFEROL DMHEMUB Discovery agent N.A. Investigative [12]
KATSUMADAIN A DM513QY Discovery agent N.A. Investigative [7]
MACLURAXANTHONE DMOMG7S Discovery agent N.A. Investigative [14]
MANGIFERIN DMWAF5Z Discovery agent N.A. Investigative [14]
MANGOSTANIN DMOWZUB Discovery agent N.A. Investigative [10]
MANGOSTANOL DMG3DUE Discovery agent N.A. Investigative [10]
MANGOSTENONE F DMNRZ3S Discovery agent N.A. Investigative [10]
MANGOSTENONE G DM4I2NR Discovery agent N.A. Investigative [10]
MANGOSTIN DMYQGDV Discovery agent N.A. Investigative [10]
NEORAUTENOL DM5GMOJ Discovery agent N.A. Investigative [13]
O-Sialic Acid DMCAR7B Discovery agent N.A. Investigative [9]
PHASEOLIN DM7H5KY Discovery agent N.A. Investigative [13]
PHASEOLLIDIN DMSQ10I Discovery agent N.A. Investigative [13]
RHODIOLININ DMH9QAF Discovery agent N.A. Investigative [12]
SMEATHXANTHONE A DMZC2BT Discovery agent N.A. Investigative [10]
------------------------------------------------------------------------------------
⏷ Show the Full List of 62 Investigative Drug(s)

References

1 Developing new antiviral agents for influenza treatment: what does the future hold Clin Infect Dis. 2009 Jan 1;48 Suppl 1:S3-13.
2 Current and future antiviral therapy of severe seasonal and avian influenza. Antiviral Res. 2008 Apr;78(1):91-102.
3 How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
4 Inhibition of neuraminidase inhibitor-resistant influenza virus by DAS181, a novel sialidase fusion protein. PLoS One. 2009 Nov 6;4(11):e7838.
5 CN patent application no. 104447481, Benzoic acid thiourea anti-influenza virus compounds as well as preparation method and use thereof.
6 US patent application no. 2010,0081,713, Compositions and methods for treating viral infections.
7 Antiviral potential and molecular insight into neuraminidase inhibiting diarylheptanoids from Alpinia katsumadai. J Med Chem. 2010 Jan 28;53(2):778-86.
8 DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-41.
9 The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
10 Xanthones with neuraminidase inhibitory activity from the seedcases of Garcinia mangostana. Bioorg Med Chem. 2010 Sep 1;18(17):6258-64.
11 Antiviral agents active against influenza A viruses. Nat Rev Drug Discov. 2006 Dec;5(12):1015-25.
12 Neuraminidase inhibitory activities of flavonols isolated from Rhodiola rosea roots and their in vitro anti-influenza viral activities. Bioorg Med Chem. 2009 Oct 1;17(19):6816-23.
13 Prenylated pterocarpans as bacterial neuraminidase inhibitors. Bioorg Med Chem. 2010 May 1;18(9):3335-44.
14 Characteristic of neuraminidase inhibitory xanthones from Cudrania tricuspidata. Bioorg Med Chem. 2009 Apr 1;17(7):2744-50.