General Information of Drug Therapeutic Target (DTT) (ID: TTEYTKG)

DTT Name Carbonic anhydrase XIV (CA-XIV)
Synonyms UNQ690/PRO1335; Carbonic anhydrase 14; Carbonate dehydratase XIV
Gene Name CA14
DTT Type
Successful target
[1]
BioChemical Class
Alpha-carbonic anhydrase
UniProt ID
CAH14_HUMAN
TTD ID
T31992
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
EC 4.2.1.1
Sequence
MLFSALLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPD
LPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGG
SEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSH
LHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQ
LEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYTTGEMLSLGVGILVG
CLCLLLAVYFIARKIRKKRLENRKSVVFTSAQATTEA
Function Reversible hydration of carbon dioxide.
KEGG Pathway
Nitrogen metabolism (hsa00910 )
Reactome Pathway
Reversible hydration of carbon dioxide (R-HSA-1475029 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTT
2 Approved Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Sulfamylon DMIO1K0 Bacterial infection 1A00-1C4Z Approved [1]
TRIENTINE DMD2WPG Inborn error of metabolism 5C50-5C59 Approved [2]
------------------------------------------------------------------------------------
4 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Curcumin DMQPH29 Solid tumour/cancer 2A00-2F9Z Phase 3 [3]
PARABEN DMEW5Z8 N. A. N. A. Phase 3 [4]
PHENOL DM1QSM3 N. A. N. A. Phase 2/3 [3]
Coumate DMVKW0N Breast cancer 2C60-2C65 Phase 2 [5]
------------------------------------------------------------------------------------
1 Patented Agent(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
FERULIC ACID DMJC7NF Discovery agent N.A. Patented [4]
------------------------------------------------------------------------------------
1 Discontinued Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
SPERMINE DMD4BFY N. A. N. A. Terminated [2]
------------------------------------------------------------------------------------
66 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
2,3-dihydro-1H-indene-5-sulfonamide DM46MKY Discovery agent N.A. Investigative [6]
2,4-Disulfamyltrifluoromethylaniline DM2AW0Z Discovery agent N.A. Investigative [1]
2-acetamido-2,3-dihydro-1H-indene-5-sulfonic acid DMIQM4O Discovery agent N.A. Investigative [6]
2-amino-2,3-dihydro-1H-indene-5-sulfonamide DMQOCAY Discovery agent N.A. Investigative [6]
2-Amino-benzenesulfonamide DMEMANH Discovery agent N.A. Investigative [1]
2-Amino-indan-5-sulfonic acid DMCUSH1 Discovery agent N.A. Investigative [6]
2-oxo-2H-chromene-3-carboxylic acid DMFN769 Discovery agent N.A. Investigative [7]
2-oxo-2H-thiochromene-3-carboxylic acid DMZTCOM Discovery agent N.A. Investigative [7]
3-Amino-benzenesulfonamide DME0TNA Discovery agent N.A. Investigative [1]
4,4'-thiodipyridine-3-sulfonamide DM0K5JM Discovery agent N.A. Investigative [8]
4-(2-AMINOETHYL)BENZENESULFONAMIDE DMEK6WX Discovery agent N.A. Investigative [1]
4-(2-Hydroxy-ethyl)-benzenesulfonamide DM1C5U6 Discovery agent N.A. Investigative [1]
4-(2-Methyl-8-quinolinoxy)-3-pyridinesulfonamide DME6DHX Discovery agent N.A. Investigative [8]
4-(2-Propynylthio)pyridine-3-sulfonamide DMT9RAC Discovery agent N.A. Investigative [8]
4-(5-Methyl-2-pirazolino)-3-pyridinesulfonamide DMKT20Q Discovery agent N.A. Investigative [8]
4-(Allylamino)-3-pyridinesulfonamide DM6MQCI Discovery agent N.A. Investigative [8]
4-(Carbamolymethylthio)pyridine-3-sulfonamide DM12R4M Discovery agent N.A. Investigative [8]
4-(Cyanomethylthio)pyridine-3-sulfonamide DMZP20H Discovery agent N.A. Investigative [8]
4-(hydroxymethyl)benzenesulfonamide DMR6VWL Discovery agent N.A. Investigative [1]
4-(Methylhydrazino)-3-pyridinesulfonamide DM4BPL1 Discovery agent N.A. Investigative [8]
4-(Quinolinoxy)-3-pyridinesulfonamide DMPNXFA Discovery agent N.A. Investigative [8]
4-Amino-3-bromo-benzenesulfonamide DMVUCZK Discovery agent N.A. Investigative [1]
4-Amino-3-chloro-benzenesulfonamide DMERTQ4 Discovery agent N.A. Investigative [1]
4-Amino-3-fluoro-benzenesulfonamide DMIQ3VR Discovery agent N.A. Investigative [1]
4-Amino-3-iodo-benzenesulfonamide DMCOYHR Discovery agent N.A. Investigative [1]
4-AMINOPHENOL DMYC1T6 Discovery agent N.A. Investigative [9]
4-Benzythiopyridine-3-sulfonamide DMI1EFY Discovery agent N.A. Investigative [8]
4-Ethoxy-3-pyridinesulfonamide DM8WAOR Discovery agent N.A. Investigative [8]
4-Hydrazino-3-pyridinesulfonamide DMSZMQU Discovery agent N.A. Investigative [8]
4-Hydrazino-benzenesulfonamide DM49B18 Discovery agent N.A. Investigative [1]
4-Methylthiopyridine-3-sulfonamide DMEB5XP Discovery agent N.A. Investigative [8]
6-(aminomethyl)-2H-chromen-2-one DMJU9TG Discovery agent N.A. Investigative [7]
6-(hydroxymethyl)-2H-chromen-2-one DM5TOX2 Discovery agent N.A. Investigative [7]
6-Hydroxy-benzothiazole-2-sulfonic acid amide DM2B4S5 Discovery agent N.A. Investigative [1]
6-methoxy-2-oxo-2H-chromene-3-carboxylic acid DM7WH82 Discovery agent N.A. Investigative [7]
6-methyl-2-oxo-2H-chromene-3-carboxylic acid DMZ6HQL Discovery agent N.A. Investigative [7]
7-(benzyloxy)-2H-chromen-2-one DMTKFPW Discovery agent N.A. Investigative [7]
7-butoxy-2H-chromen-2-one DM78C5A Discovery agent N.A. Investigative [7]
7-methoxy-2-oxo-2H-chromene-4-carboxylic acid DMJITU0 Discovery agent N.A. Investigative [7]
7-phenethoxy-2H-chromen-2-one DM8Q267 Discovery agent N.A. Investigative [7]
7-propoxy-2H-chromen-2-one DMD5CB6 Discovery agent N.A. Investigative [7]
8-methoxy-2-oxo-2H-chromene-3-carboxylic acid DMHCWY8 Discovery agent N.A. Investigative [7]
BENZOLAMIDE DME5QPX Discovery agent N.A. Investigative [1]
Beta-D-Mannose DMHIG9K Discovery agent N.A. Investigative [10]
Carzenide DMVD481 Discovery agent N.A. Investigative [1]
CATECHIN DMY38SB Discovery agent N.A. Investigative [3]
CL-5343 DM9AFZ3 Solid tumour/cancer 2A00-2F9Z Investigative [11]
COUMARIN DM0N8ZM Discovery agent N.A. Investigative [7]
Decane-1,10-diyl disulfamate DM1ESVR Discovery agent N.A. Investigative [12]
Decyl sulfamate DMIERWO Discovery agent N.A. Investigative [12]
ELLAGIC ACID DMX8BS5 Discovery agent N.A. Investigative [4]
ETHOXYCOUMARIN DMSKU4M Discovery agent N.A. Investigative [7]
Ethyl 7-methoxy-2-oxo-2H-chromene-3-carboxylate DMWIB0V Discovery agent N.A. Investigative [7]
GALLICACID DM6Y3A0 Discovery agent N.A. Investigative [4]
HERNIARIN DM9UASM Discovery agent N.A. Investigative [7]
Hexane-1,6-diamine DMSHF0K Discovery agent N.A. Investigative [2]
N-propynyl amidebenzenesulphonide DMWTPJH Discovery agent N.A. Investigative [13]
N1-(2-aminoethyl)ethane-1,2-diamine DM6HM5S Discovery agent N.A. Investigative [2]
N1-(naphthalen-1-yl)ethane-1,2-diamine DMYGCSV Discovery agent N.A. Investigative [2]
Octane-1,8-diyl disulfamate DMBQMGH Discovery agent N.A. Investigative [12]
Octyl sulfamate DM40ZCA Discovery agent N.A. Investigative [12]
P-Coumaric Acid DMGJSVD Discovery agent N.A. Investigative [4]
Pentane-1,5-diamine DMVPZG9 Discovery agent N.A. Investigative [2]
Prop-2-ynyl 4-sulfamoylbenzoate DM8O41M Discovery agent N.A. Investigative [13]
RESORCINOL DMM37C0 Discovery agent N.A. Investigative [9]
Syringic Acid DM802V7 Discovery agent N.A. Investigative [4]
------------------------------------------------------------------------------------
⏷ Show the Full List of 66 Investigative Drug(s)

Molecular Expression Atlas (MEA) of This DTT

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTT
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Breast cancer 2C82 Breast tissue 5.79E-07 -0.09 -0.16
------------------------------------------------------------------------------------

References

1 Carbonic anhydrase inhibitors: inhibition of the transmembrane isozyme XIV with sulfonamides. Bioorg Med Chem Lett. 2005 Sep 1;15(17):3828-33.
2 Polyamines inhibit carbonic anhydrases by anchoring to the zinc-coordinated water molecule. J Med Chem. 2010 Aug 12;53(15):5511-22.
3 Carbonic anhydrase inhibitors. Antioxidant polyphenols effectively inhibit mammalian isoforms I-XV. Bioorg Med Chem Lett. 2010 Sep 1;20(17):5050-3.
4 Carbonic anhydrase inhibitors. Inhibition of mammalian isoforms I-XIV with a series of natural product polyphenols and phenolic acids. Bioorg Med Chem. 2010 Mar 15;18(6):2159-2164.
5 Carbonic anhydrase inhibitors. Interaction of the antitumor sulfamate EMD 486019 with twelve mammalian carbonic anhydrase isoforms: Kinetic and X-r... Bioorg Med Chem Lett. 2008 Aug 1;18(15):4282-6.
6 Indanesulfonamides as carbonic anhydrase inhibitors and anticonvulsant agents: structure-activity relationship and pharmacological evaluation. Eur J Med Chem. 2008 Dec;43(12):2853-60.
7 Deciphering the mechanism of carbonic anhydrase inhibition with coumarins and thiocoumarins. J Med Chem. 2010 Jan 14;53(1):335-44.
8 Carbonic anhydrase inhibitors: synthesis and inhibition of the human cytosolic isozymes I and II and transmembrane isozymes IX, XII (cancer-associa... Eur J Med Chem. 2010 Jun;45(6):2396-404.
9 Carbonic anhydrase inhibitors: inhibition of mammalian isoforms I-XIV with a series of substituted phenols including paracetamol and salicylic acid. Bioorg Med Chem. 2008 Aug 1;16(15):7424-8.
10 How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
11 Carbonic anhydrase inhibitors. The X-ray crystal structure of human isoform II in adduct with an adamantyl analogue of acetazolamide resides in a l... Bioorg Med Chem Lett. 2010 Aug 1;20(15):4376-81.
12 Carbonic anhydrase inhibitors. Comparison of aliphatic sulfamate/bis-sulfamate adducts with isozymes II and IX as a platform for designing tight-bi... J Med Chem. 2009 Oct 8;52(19):5990-8.
13 Inhibition of membrane-associated carbonic anhydrase isozymes IX, XII and XIV with a library of glycoconjugate benzenesulfonamides. Bioorg Med Chem Lett. 2007 Feb 15;17(4):987-92.