Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTSYM0R)

DTT Name Carbonic anhydrase XII (CA-XII)
Synonyms Tumor antigen HOM-RCC-3.1.3; Carbonic anhydrase 12; Carbonate dehydratase XII
Gene Name CA12
DTT Type
Successful target
 [1]
Related Disease
Bacterial infection [ICD-11: 1A00-1C4Z]
Seborrhoeic dermatitis [ICD-11: EA81]
BioChemical Class
Alpha-carbonic anhydrase
UniProt ID
CAH12_HUMAN
TTD ID
T16987
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
EC 4.2.1.1
Sequence
MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDL
HSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHL
HWGNPNDPHGSEHTVSGQHFAAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFN
PSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFR
NPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKFDERLVYTSFSQVQVCTAAGL
SLGIILSLALAGILGICIVVVVSIWLFRRKSIKKGDNKGVIYKPATKMETEAHA
Function Reversible hydration of carbon dioxide.
KEGG Pathway
( )
Reactome Pathway
Reversible hydration of carbon dioxide (R-HSA-1475029 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTT
2 Approved Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Salicyclic acid DM2F8XZ Seborrhoeic dermatitis EA81 Approved [2]
Sulfamylon DMIO1K0 Bacterial infection 1A00-1C4Z Approved [1]
------------------------------------------------------------------------------------
4 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Curcumin DMQPH29 Solid tumour/cancer 2A00-2F9Z Phase 3 [3]
PARABEN DMEW5Z8 N. A. N. A. Phase 3 [4]
Phenol DM1QSM3 N. A. N. A. Phase 2/3 [3]
Coumate DMVKW0N Breast cancer 2C60-2C65 Phase 2 [5]
------------------------------------------------------------------------------------
1 Patented Agent(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Ferulic Acid DMJC7NF Discovery agent N.A. Patented [4]
------------------------------------------------------------------------------------
100 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
1,4-Dihydro-1-methyl-4-oxo-3-pyridinesulfonamide DMNHGVD Discovery agent N.A. Investigative [6]
1-Benzyl-1,4-dihydro-4-oxo-3-pyridinesulfonamide DMUXSH5 Discovery agent N.A. Investigative [6]
2,2,2-Trifluoro-N-(4-sulfamoyl-phenyl)-acetamide DMG4ITB Discovery agent N.A. Investigative [7]
2,2-Dimethyl-N-(4-sulfamoyl-phenyl)-propionamide DMATB8H Discovery agent N.A. Investigative [7]
2,3-dihydro-1H-indene-5-sulfonamide DM46MKY Discovery agent N.A. Investigative [8]
2,4-Disulfamyltrifluoromethylaniline DM2AW0Z Discovery agent N.A. Investigative [9]
2-acetamido-2,3-dihydro-1H-indene-5-sulfonic acid DMIQM4O Discovery agent N.A. Investigative [8]
2-amino-2,3-dihydro-1H-indene-5-sulfonamide DMQOCAY Discovery agent N.A. Investigative [8]
2-Amino-benzenesulfonamide DMEMANH Discovery agent N.A. Investigative [9]
2-Amino-indan-5-sulfonic acid DMCUSH1 Discovery agent N.A. Investigative [8]
2-hydrazinylbenzenesulfonamide DMCNXZM Discovery agent N.A. Investigative [9]
2-oxo-2H-chromene-3-carboxylic acid DMFN769 Discovery agent N.A. Investigative [10]
2-oxo-2H-thiochromene-3-carboxylic acid DMZTCOM Discovery agent N.A. Investigative [10]
3-((4-aminophenyl)diazenyl)benzenesulfonamide DM37X04 Discovery agent N.A. Investigative [11]
3-((4-hydroxyphenyl)diazenyl)benzenesulfonamide DMAPZQW Discovery agent N.A. Investigative [11]
3-(3-Phenyl-ureido)-benzenesulfonamide DM314ZE Discovery agent N.A. Investigative [7]
3-(4'-Hydroxyphenyl)diazenylbenzenesulfonamide DM18MOH Discovery agent N.A. Investigative [11]
3-Amino-benzenesulfonamide DME0TNA Discovery agent N.A. Investigative [12]
4,4'-thiodipyridine-3-sulfonamide DM0K5JM Discovery agent N.A. Investigative [13]
4-((4-hydroxyphenyl)diazenyl)benzenesulfonamide DM5EP3V Discovery agent N.A. Investigative [11]
4-(2-AMINOETHYL)BENZENESULFONAMIDE DMEK6WX Discovery agent N.A. Investigative [9]
4-(2-Hydroxy-ethyl)-benzenesulfonamide DM1C5U6 Discovery agent N.A. Investigative [9]
4-(2-Methyl-8-quinolinoxy)-3-pyridinesulfonamide DME6DHX Discovery agent N.A. Investigative [13]
4-(2-Propynylthio)pyridine-3-sulfonamide DMT9RAC Discovery agent N.A. Investigative [13]
4-(4'-N-Methylphenyl)diazenylbenzenesulfonamide DMGVNE3 Discovery agent N.A. Investigative [11]
4-(4-Cyanophenoxy)-3-pyridinesulfonamide DMNEAJH Discovery agent N.A. Investigative [13]
4-(4-Fluorophenoxy)-3-pyridinesulfonamide DMRJLAP Discovery agent N.A. Investigative [13]
4-(5-Methyl-2-pirazolino)-3-pyridinesulfonamide DMKT20Q Discovery agent N.A. Investigative [13]
4-(Allylamino)-3-pyridinesulfonamide DM6MQCI Discovery agent N.A. Investigative [13]
4-(Carbamolymethylthio)pyridine-3-sulfonamide DM12R4M Discovery agent N.A. Investigative [13]
4-(Cyanomethylthio)pyridine-3-sulfonamide DMZP20H Discovery agent N.A. Investigative [13]
4-(hydroxymethyl)benzenesulfonamide DMR6VWL Discovery agent N.A. Investigative [9]
4-(Methylhydrazino)-3-pyridinesulfonamide DM4BPL1 Discovery agent N.A. Investigative [13]
4-(N-Methyl-hydrazino)-benzenesulfonamide DMADWTI Discovery agent N.A. Investigative [9]
4-(N-Oxide-2-pyridylthio)pyridine-3-sulfonamide DMYCV8E Discovery agent N.A. Investigative [13]
4-(Quinolinoxy)-3-pyridinesulfonamide DMPNXFA Discovery agent N.A. Investigative [13]
4-Amino-3-bromo-benzenesulfonamide DMVUCZK Discovery agent N.A. Investigative [9]
4-Amino-3-chloro-benzenesulfonamide DMERTQ4 Discovery agent N.A. Investigative [9]
4-Amino-3-fluoro-benzenesulfonamide DMIQ3VR Discovery agent N.A. Investigative [9]
4-Amino-3-iodo-benzenesulfonamide DMCOYHR Discovery agent N.A. Investigative [9]
4-Benzenesulfonylamino-benzenesulfonamide DMC7HKA Discovery agent N.A. Investigative [7]
4-Benzythiopyridine-3-sulfonamide DMI1EFY Discovery agent N.A. Investigative [13]
4-CYANOPHENOL DMN12EX Discovery agent N.A. Investigative [2]
4-Ethoxy-3-pyridinesulfonamide DM8WAOR Discovery agent N.A. Investigative [13]
4-Hydrazino-3-pyridinesulfonamide DMSZMQU Discovery agent N.A. Investigative [13]
4-Hydrazino-benzenesulfonamide DM49B18 Discovery agent N.A. Investigative [12]
4-Methanesulfonylamino-benzenesulfonamide DMPH4C8 Discovery agent N.A. Investigative [7]
4-Methoxy-3-pyridinesulfonamide DMJIX7H Discovery agent N.A. Investigative [13]
4-Methylamino-benzenesulfonamide DM5XMI9 Discovery agent N.A. Investigative [9]
4-Methylthiopyridine-3-sulfonamide DMEB5XP Discovery agent N.A. Investigative [13]
4-[2-(3-Phenyl-ureido)-ethyl]-benzenesulfonamide DMGXM9C Discovery agent N.A. Investigative [7]
6-(aminomethyl)-2H-chromen-2-one DMJU9TG Discovery agent N.A. Investigative [10]
6-(hydroxymethyl)-2H-chromen-2-one DM5TOX2 Discovery agent N.A. Investigative [10]
6-Hydroxy-benzothiazole-2-sulfonic acid amide DM2B4S5 Discovery agent N.A. Investigative [9]
6-methoxy-2-oxo-2H-chromene-3-carboxylic acid DM7WH82 Discovery agent N.A. Investigative [10]
6-methyl-2-oxo-2H-chromene-3-carboxylic acid DMZ6HQL Discovery agent N.A. Investigative [10]
7-(benzyloxy)-2H-chromen-2-one DMTKFPW Discovery agent N.A. Investigative [10]
7-butoxy-2H-chromen-2-one DM78C5A Discovery agent N.A. Investigative [10]
7-methoxy-2-oxo-2H-chromene-4-carboxylic acid DMJITU0 Discovery agent N.A. Investigative [10]
7-phenethoxy-2H-chromen-2-one DM8Q267 Discovery agent N.A. Investigative [10]
7-propoxy-2H-chromen-2-one DMD5CB6 Discovery agent N.A. Investigative [10]
8-methoxy-2-oxo-2H-chromene-3-carboxylic acid DMHCWY8 Discovery agent N.A. Investigative [10]
ACETYLSULFANILAMIDE DMG8P24 Discovery agent N.A. Investigative [7]
BENZOLAMIDE DME5QPX Discovery agent N.A. Investigative [9]
Carzenide DMVD481 Discovery agent N.A. Investigative [9]
CATECHIN DMY38SB Discovery agent N.A. Investigative [3]
Catechol DML0YEK Discovery agent N.A. Investigative [4]
CL-5343 DM9AFZ3 Solid tumour/cancer 2A00-2F9Z Investigative [14]
Coumarin DM0N8ZM Discovery agent N.A. Investigative [10]
Decane-1,10-diyl disulfamate DM1ESVR Discovery agent N.A. Investigative [15]
Decyl sulfamate DMIERWO Discovery agent N.A. Investigative [15]
ELLAGIC ACID DMX8BS5 Discovery agent N.A. Investigative [4]
ETHOXYCOUMARIN DMSKU4M Discovery agent N.A. Investigative [10]
Ethyl 7-methoxy-2-oxo-2H-chromene-3-carboxylate DMWIB0V Discovery agent N.A. Investigative [10]
GALLICACID DM6Y3A0 Discovery agent N.A. Investigative [4]
HERNIARIN DM9UASM Discovery agent N.A. Investigative [10]
Hexane-1,6-diamine DMSHF0K Discovery agent N.A. Investigative [16]
N-(4-cyanophenyl)sulfamide DMW8S2D Discovery agent N.A. Investigative [17]
N-(4-Sulfamoyl-phenyl)-benzamide DMZDACT Discovery agent N.A. Investigative [7]
N-(4-Sulfamoyl-phenyl)-butyramide DM3FW9Q Discovery agent N.A. Investigative [7]
N-(4-Sulfamoyl-phenyl)-isobutyramide DMJCXYQ Discovery agent N.A. Investigative [7]
N-(4-Sulfamoyl-phenyl)-propionamide DM7MHQD Discovery agent N.A. Investigative [7]
N-(pentafluorophenyl)sulfamide DME45J8 Discovery agent N.A. Investigative [17]
N-hydroxysulfamide DMTDBMU Discovery agent N.A. Investigative [18]
N-propynyl amidebenzenesulphonide DMWTPJH Discovery agent N.A. Investigative [19]
N1-(2-aminoethyl)ethane-1,2-diamine DM6HM5S Discovery agent N.A. Investigative [16]
N1-(naphthalen-1-yl)ethane-1,2-diamine DMYGCSV Discovery agent N.A. Investigative [16]
Octane-1,8-diyl disulfamate DMBQMGH Discovery agent N.A. Investigative [15]
Octyl sulfamate DM40ZCA Discovery agent N.A. Investigative [15]
P-Coumaric Acid DMGJSVD Discovery agent N.A. Investigative [4]
P-toluenesulfonamide DMPEKTO Discovery agent N.A. Investigative [9]
Pentane-1,5-diamine DMVPZG9 Discovery agent N.A. Investigative [16]
Pentanoic acid (4-sulfamoyl-phenyl)-amide DMAZ07T Discovery agent N.A. Investigative [7]
Prop-2-ynyl 4-sulfamoylbenzoate DM8O41M Discovery agent N.A. Investigative [19]
Resorcinol DMM37C0 Discovery agent N.A. Investigative [2]
Saccharin DMRA736 Discovery agent N.A. Investigative [20]
Sodium N-methylphenylaminomethanesulfonate DMBVQI4 Discovery agent N.A. Investigative [11]
Sodium phenylaminomethanesulfonate DMJ7I4U Discovery agent N.A. Investigative [11]
Syringic Acid DM802V7 Discovery agent N.A. Investigative [4]
Thioureido sulfonamide DM8WYEM Discovery agent N.A. Investigative [21]
------------------------------------------------------------------------------------
⏷ Show the Full List of 100 Investigative Drug(s)

Molecular Expression Atlas (MEA) of This DTT

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTT
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Breast cancer 2C82 Breast tissue 3.29E-21 1.27 1.02
------------------------------------------------------------------------------------

References

1 Sulfonamide linked neoglycoconjugates--a new class of inhibitors for cancer-associated carbonic anhydrases. J Med Chem. 2010 Apr 8;53(7):2913-26.
2 Carbonic anhydrase inhibitors: inhibition of mammalian isoforms I-XIV with a series of substituted phenols including paracetamol and salicylic acid. Bioorg Med Chem. 2008 Aug 1;16(15):7424-8.
3 Carbonic anhydrase inhibitors. Antioxidant polyphenols effectively inhibit mammalian isoforms I-XV. Bioorg Med Chem Lett. 2010 Sep 1;20(17):5050-3.
4 Carbonic anhydrase inhibitors. Inhibition of mammalian isoforms I-XIV with a series of natural product polyphenols and phenolic acids. Bioorg Med Chem. 2010 Mar 15;18(6):2159-2164.
5 Carbonic anhydrase inhibitors. Interaction of the antitumor sulfamate EMD 486019 with twelve mammalian carbonic anhydrase isoforms: Kinetic and X-r... Bioorg Med Chem Lett. 2008 Aug 1;18(15):4282-6.
6 Carbonic anhydrase inhibitors. Regioselective synthesis of novel 1-substituted 1,4-dihydro-4-oxo-3-pyridinesulfonamides and their inhibition of the... Eur J Med Chem. 2010 Sep;45(9):3656-61.
7 Carbonic anhydrase inhibitors: inhibition of the tumor-associated isozymes IX and XII with a library of aromatic and heteroaromatic sulfonamides. Bioorg Med Chem Lett. 2005 Nov 1;15(21):4862-6.
8 Indanesulfonamides as carbonic anhydrase inhibitors and anticonvulsant agents: structure-activity relationship and pharmacological evaluation. Eur J Med Chem. 2008 Dec;43(12):2853-60.
9 Carbonic anhydrase inhibitors. Inhibition of the transmembrane isozyme XII with sulfonamides-a new target for the design of antitumor and antiglauc... Bioorg Med Chem Lett. 2005 Feb 15;15(4):963-9.
10 Deciphering the mechanism of carbonic anhydrase inhibition with coumarins and thiocoumarins. J Med Chem. 2010 Jan 14;53(1):335-44.
11 Carbonic anhydrase inhibitors. Diazenylbenzenesulfonamides are potent and selective inhibitors of the tumor-associated isozymes IX and XII over the... Bioorg Med Chem. 2009 Oct 15;17(20):7093-9.
12 Carbonic anhydrase inhibitors: inhibition of the transmembrane isozyme XIV with sulfonamides. Bioorg Med Chem Lett. 2005 Sep 1;15(17):3828-33.
13 Carbonic anhydrase inhibitors: synthesis and inhibition of the human cytosolic isozymes I and II and transmembrane isozymes IX, XII (cancer-associa... Eur J Med Chem. 2010 Jun;45(6):2396-404.
14 Carbonic anhydrase inhibitors. The X-ray crystal structure of human isoform II in adduct with an adamantyl analogue of acetazolamide resides in a l... Bioorg Med Chem Lett. 2010 Aug 1;20(15):4376-81.
15 Carbonic anhydrase inhibitors. Comparison of aliphatic sulfamate/bis-sulfamate adducts with isozymes II and IX as a platform for designing tight-bi... J Med Chem. 2009 Oct 8;52(19):5990-8.
16 Polyamines inhibit carbonic anhydrases by anchoring to the zinc-coordinated water molecule. J Med Chem. 2010 Aug 12;53(15):5511-22.
17 Carbonic anhydrase inhibitors: synthesis and inhibition of cytosolic/tumor-associated carbonic anhydrase isozymes I, II, IX, and XII with N-hydroxy... Bioorg Med Chem Lett. 2005 May 2;15(9):2353-8.
18 Carbonic anhydrase inhibitors: crystallographic and solution binding studies for the interaction of a boron-containing aromatic sulfamide with mamm... Bioorg Med Chem Lett. 2010 Jun 15;20(12):3601-5.
19 Inhibition of membrane-associated carbonic anhydrase isozymes IX, XII and XIV with a library of glycoconjugate benzenesulfonamides. Bioorg Med Chem Lett. 2007 Feb 15;17(4):987-92.
20 Carbonic anhydrase inhibitors: copper(II) complexes of polyamino-polycarboxylamido aromatic/heterocyclic sulfonamides are very potent inhibitors of... Bioorg Med Chem Lett. 2008 Jan 15;18(2):836-41.
21 Carbonic anhydrase inhibitors: design of thioureido sulfonamides with potent isozyme II and XII inhibitory properties and intraocular pressure lowe... Bioorg Med Chem Lett. 2005 Sep 1;15(17):3821-7.