Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTVBI8W)

• DTT Name: Dopamine transporter (DAT)
• Synonyms: Solute carrier family 6 member 3; Sodium-dependent dopamine transporter; DAT1; DAT; DA transporter
• Gene Name: SLC6A3
• DTT Type: Successful target; [1]
• BioChemical Class: Neurotransmitter:sodium symporter
• UniProt ID: SC6A3_HUMAN
• TTD ID: T55959
• Sequence:
  MSKSKCSVGLMSSVVAPAKEPNAVGPKEVELILVKEQNGVQLTSSTLTNPRQSPVEAQDR
  ETWGKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELAL
  GQFNREGAAGVWKICPILKGVGFTVILISLYVGFFYNVIIAWALHYLFSSFTTELPWIHC
  NNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLGPPRWQL
  TACLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTALLLRGVTLPGAIDGIRAYLSV
  DFYRLCEASVWIDAATQVCFSLGVGFGVLIAFSSYNKFTNNCYRDAIVTTSINSLTSFSS
  GFVVFSFLGYMAQKHSVPIGDVAKDGPGLIFIIYPEAIATLPLSSAWAVVFFIMLLTLGI
  DSAMGGMESVITGLIDEFQLLHRHRELFTLFIVLATFLLSLFCVTNGGIYVFTLLDHFAA
  GTSILFGVLIEAIGVAWFYGVGQFSDDIQQMTGQRPSLYWRLCWKLVSPCFLLFVVVVSI
  VTFRPPHYGAYIFPDWANALGWVIATSSMAMVPIYAAYKFCSLPGSFREKLAYAIAPEKD
  RELVDRGEVRQFTLRHWLKV
• Function: Amine transporter. Terminates the action of dopamine by its high affinity sodium-dependent reuptake into presynaptic terminals.
• KEGG Pathway:
  Dopaminergic synapse (hsa04728)
  Parkinson's disease (hsa05012)
  Cocaine addiction (hsa05030)
  Amphetamine addiction (hsa05031)
  Alcoholism (hsa05034)
• Reactome Pathway: Na+/Cl- dependent neurotransmitter transporters (R-HSA-442660)

Molecular Interaction Atlas (MIA) of This DTT

8 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Altropane	DMO9WDS	Attention deficit hyperactivity disorder	6A05.Z	Approved	[2]
Cocaine	DMSOX7I	Anaesthesia	9A78.6	Approved	[3]
Dasotraline	DMLDQFV	Attention deficit hyperactivity disorder	6A05.Z	Approved	[4]
DEXMETHYLPHENIDATE HYDROCHLORIDE	DM8WBAH	Attention deficit hyperactivity disorder	6A05.Z	Approved	[5]
Ioflupane i-123	DMNARJT	Parkinson disease	8A00.0	Approved	[6]
Methylphenidate	DM7SJD6	Attention deficit hyperactivity disorder	6A05.Z	Approved	[1]
Modafinil	DMYILBE	Malignant glioma	2A00.0	Approved	[7]
Phenmetrazine	DMXYTN9	Obesity	5B81	Approved	[8]

7 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Amitifadine	DMS1X67	Obesity	5B81	Phase 3	[9]
NAV5001	DMRSI1M	Dementia	6D80-6D86	Phase 3	[2]
MIN-117	DMSLIW6	Major depressive disorder	6A70.3	Phase 2	[10]
NS 2359	DMI5HFU	Cocaine addiction	6C45.2	Phase 2	[11]
Spiroglumide	DM7NJWY	Stomach disease	DA43-DA4Y	Phase 2	[12]
GSK-1360707	DMZC9XU	Major depressive disorder	6A70.3	Phase 1	[13]
RTI-336	DMY8D5O	Cocaine addiction	6C45.2	Phase 1	[14]

12 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Amineptine	DMGVNJ7	Major depressive disorder	6A70.3	Withdrawn from market	[15]
DOV-216303	DMTE14H	Mood disorder	6A60-6E23	Discontinued in Phase 2	[11]
Manifaxine	DMRN7GC	Major depressive disorder	6A70.3	Discontinued in Phase 2	[16]
NS-2389	DMVRJ8D	Major depressive disorder	6A70.3	Discontinued in Phase 2	[17]
Radafaxine	DMARQE0	Major depressive disorder	6A70.3	Discontinued in Phase 2	[18]
SPD-473	DMTJNRL	Mood disorder	6A60-6E23	Discontinued in Phase 2	[19]
KP106	DMICLMR	Attention deficit hyperactivity disorder	6A05.Z	Discontinued in Phase 1	[20]
NSD-644	DMNL9DS	Neurological disorder	6B60	Discontinued in Phase 1	[21]
RG-7166	DMKLPMW	Major depressive disorder	6A70.3	Discontinued in Phase 1	[22]
Vanoxerine	DMBQPA5	Cocaine addiction	6C45.2	Discontinued in Phase 1	[23]
Fluoratec	DM7JT3D	Attention deficit hyperactivity disorder	6A05.Z	Terminated	[24]
Seridopidine	DMTBWU1	Neurological disorder	6B60	Terminated	[25]

252 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
(+/-)-3-((naphthalen-2-yloxy)methyl)pyrrolidine	DML68KX	Discovery agent	N.A.	Investigative	[26]
(+/-)-threo-3',4'-Dichloromethylphenidate amide	DMFSZ8H	Discovery agent	N.A.	Investigative	[27]
(+/-)-threo-3',4'-Dichlororitalinol methyl ether	DM5MLZ0	Discovery agent	N.A.	Investigative	[27]
(+/-)-threo-3',5'-Dichloromethylphenidate	DM4UQBI	Discovery agent	N.A.	Investigative	[27]
(+/-)-threo-3',5'-Dimethylmethylphenidate	DMUWKNX	Discovery agent	N.A.	Investigative	[27]
(+/-)-threo-3-Fluororitalinol	DM3O4FI	Discovery agent	N.A.	Investigative	[27]
(+/-)-threo-4'-Ethylmethylphenidate	DMU5T28	Discovery agent	N.A.	Investigative	[27]
(+/-)-threo-Benzylphenidate	DM9TSW0	Discovery agent	N.A.	Investigative	[27]
(+/-)-threo-Methylphenidate amide	DMRZOVP	Discovery agent	N.A.	Investigative	[27]
(+/-)-threo-N-(2-Chlorobenzyl)methylphenidate	DM80JOH	Discovery agent	N.A.	Investigative	[27]
(+/-)-threo-N-(2-Methylfuran)methylphenidate	DM6CWBO	Discovery agent	N.A.	Investigative	[27]
(+/-)-threo-N-(2-Methylpyridine)methylphenidate	DMN6ZX9	Discovery agent	N.A.	Investigative	[27]
(+/-)-threo-N-(2-Methylthiopene)methylphenidate	DMWUGSV	Discovery agent	N.A.	Investigative	[27]
(+/-)-threo-N-(2-Phenylethyl)methylphenidate	DM2WRED	Discovery agent	N.A.	Investigative	[27]
(+/-)-threo-N-(2-Phenylethyl)ritalinol	DM9Y3MT	Discovery agent	N.A.	Investigative	[27]
(+/-)-threo-N-(3-Chlorobenzyl)methylphenidate	DMU08WO	Discovery agent	N.A.	Investigative	[27]
(+/-)-threo-N-(3-Methylfuran)methylphenidate	DMHPE4L	Discovery agent	N.A.	Investigative	[27]
(+/-)-threo-N-(3-Methylpyridine)methylphenidate	DMDMTZK	Discovery agent	N.A.	Investigative	[27]
(+/-)-threo-N-(3-Methylthiopene)methylphenidate	DMIJ7PC	Discovery agent	N.A.	Investigative	[27]
(+/-)-threo-N-(3-Phenylpropyl)methylphenidate	DMD926H	Discovery agent	N.A.	Investigative	[27]
(+/-)-threo-N-(3-Phenylpropyl)ritalinol	DMVP183	Discovery agent	N.A.	Investigative	[27]
(+/-)-threo-N-(4-Chlorobenzyl)methylphenidate	DM3HWQY	Discovery agent	N.A.	Investigative	[27]
(+/-)-threo-N-(4-Methoxybenzyl)methylphenidate	DMHIKD2	Discovery agent	N.A.	Investigative	[27]
(+/-)-threo-N-(4-Methylpyridine)methylphenidate	DM9QIAL	Discovery agent	N.A.	Investigative	[27]
(+/-)-threo-N-(4-Nitrobenzyl)methylphenidate	DMB3JY8	Discovery agent	N.A.	Investigative	[27]
(+/-)-threo-N-(4-Phenylbutyl)methylphenidate	DMK6IJW	Discovery agent	N.A.	Investigative	[27]
(+/-)-threo-N-(4-Phenylbutyl)ritalinol	DMG3FA1	Discovery agent	N.A.	Investigative	[27]
(+/-)-threo-N-(5-Phenylpentyl)methylphenidate	DMHNQO9	Discovery agent	N.A.	Investigative	[27]
(+/-)-threo-N-(6-Phenylhexyl)methylphenidate	DMG1K5H	Discovery agent	N.A.	Investigative	[27]
(+/-)-threo-N-Allylmethylphenidate	DMYNO71	Discovery agent	N.A.	Investigative	[27]
(+/-)-threo-N-Benzyl-3',4'-dichlororitalinol	DMOJXCK	Discovery agent	N.A.	Investigative	[27]
(+/-)-threo-N-Benzyl-3'-chloromethylphenidate	DM15LE0	Discovery agent	N.A.	Investigative	[27]
(+/-)-threo-N-Benzylmethylphenidate amide	DMUACDH	Discovery agent	N.A.	Investigative	[27]
(+/-)-threo-N-Methyl-30-methylmethylphenidate	DM6D18M	Discovery agent	N.A.	Investigative	[27]
(+/-)-threo-N-Propargylmethylphenidate	DMYE0MZ	Discovery agent	N.A.	Investigative	[27]
(1-Phenyl-ethyl)-(2-phenyl-quinazolin-4-yl)-amine	DMECH9W	Discovery agent	N.A.	Investigative	[28]
(2R,3R)-iodoreboxetine	DMYRHFI	Discovery agent	N.A.	Investigative	[29]
(2R,3S)-2-[(2-Iodophenoxy)phenylmethyl]morpholine	DMY2FX8	Discovery agent	N.A.	Investigative	[30]
(2R,3S)-2-[(3-Iodophenoxy)phenylmethyl]morpholine	DM260TI	Discovery agent	N.A.	Investigative	[30]
(2R,3S)-2-[(4-Iodophenoxy)phenylmethyl]morpholine	DMKM8E2	Discovery agent	N.A.	Investigative	[30]
(2S,3S)-2-(m-Tolyl)-3,5,5-trimethylmorpholin-2-ol	DMDUI8R	Discovery agent	N.A.	Investigative	[31]
(2S,3S)-2-Phenyl-3,5,5-trimethylmorpholin-2-ol	DMDUGZS	Discovery agent	N.A.	Investigative	[31]
(2S,3S)-iodoreboxetine	DMBEOIQ	Discovery agent	N.A.	Investigative	[29]
(cis)-1,6-diphenyl-3-aza-bicyclo[3.1.0]hexane	DMMC139	Discovery agent	N.A.	Investigative	[32]
(R)-2-(2-phenyl-2-(piperazin-1-yl)ethyl)phenol	DM74IWX	Discovery agent	N.A.	Investigative	[33]
(R)-3-(naphthalen-2-ylmethoxy)pyrrolidine	DM94B12	Discovery agent	N.A.	Investigative	[26]
(R)-DULOXETINE	DMECK7H	Discovery agent	N.A.	Investigative	[34]
(R)-N-isobutyl-N-(pyrrolidin-3-yl)-2-naphthamide	DMJFH97	Discovery agent	N.A.	Investigative	[35]
(R)-Norfluoxetine	DMS30KU	Discovery agent	N.A.	Investigative	[36]
(RS/SR)-2-[1-(3,4-dichlorophenyl)butyl]piperidine	DM6EYQ2	Discovery agent	N.A.	Investigative	[37]
(RS/SR)-2-[1-(4-chlorophenyl)butyl]piperidine	DMGHWJ5	Discovery agent	N.A.	Investigative	[37]
(RS/SR)-2-[1-(4-chlorophenyl)ethyl]piperidine	DMAIGM2	Discovery agent	N.A.	Investigative	[37]
(RS/SR)-2-[1-(4-chlorophenyl)hexyl]piperidine	DMDVMSP	Discovery agent	N.A.	Investigative	[37]
(RS/SR)-2-[1-(4-chlorophenyl)pentyl]piperidine	DMMUV7R	Discovery agent	N.A.	Investigative	[37]
(RS/SR)-2-[1-(4-chlorophenyl)propyl]piperidine	DMPQAGL	Discovery agent	N.A.	Investigative	[37]
(S)-3-(naphthalen-2-ylmethoxy)pyrrolidine	DM5ILK1	Discovery agent	N.A.	Investigative	[26]
(S)-Norfluoxetine	DM8ZTPF	Discovery agent	N.A.	Investigative	[36]
1-(1,4-diphenylbutan-2-yl)piperazine	DM8Z1QU	Discovery agent	N.A.	Investigative	[38]
1-(1-(4-FLUOROPHENYL)-2-(2-(TRIFLUOROMETHOXY)PHENYL)ETHYL)PIPERAZINE (ENANTIOMERIC MIX)	DMS9PZ7	Discovery agent	N.A.	Investigative	[33]
1-(1-(benzo[b]thiophen-2-yl)cyclohexyl)piperidine	DMPGM0V	Discovery agent	N.A.	Investigative	[39]
1-(1-Benzo[b]thiophen-2-yl-cycloheptyl)-azepane	DM2T1CD	Discovery agent	N.A.	Investigative	[40]
1-(1-Benzo[b]thiophen-2-yl-cyclohexyl)-azepane	DMEFP15	Discovery agent	N.A.	Investigative	[40]
1-(1-Benzo[b]thiophen-2-yl-cyclopentyl)-azepane	DM1Q36W	Discovery agent	N.A.	Investigative	[40]
1-(1-phenyl-2-(2-propoxyphenyl)ethyl)piperazine	DM54ZKU	Discovery agent	N.A.	Investigative	[33]
1-(2,3-Dihydro-1H-indol-5-ylmethyl)-propylamine	DM0URSE	Discovery agent	N.A.	Investigative	[41]
1-(2-(2-(DIFLUOROMETHOXY)PHENYL)-1-PHENYLETHYL)PIPERAZINE (ENANTIOMERIC MIX)	DMUJ2WB	Discovery agent	N.A.	Investigative	[33]
1-(2-(2-chlorophenyl)-1-phenylethyl)piperazine	DMUM4YQ	Discovery agent	N.A.	Investigative	[42]
1-(2-(2-methoxyphenyl)-1-phenylethyl)piperazine	DM2H38V	Discovery agent	N.A.	Investigative	[42]
1-(2-(4-fluorophenoxy)phenyl)piperazine	DMU082P	Discovery agent	N.A.	Investigative	[43]
1-(2-(phenoxymethyl)phenyl)piperazine	DM7Z19T	Discovery agent	N.A.	Investigative	[43]
1-(2-methylphenyl)-2-pyrrolidin-1-yl-pentan-1-one	DMBWCOZ	Discovery agent	N.A.	Investigative	[44]
1-(2-phenoxyphenyl)piperazine	DMWFCYN	Discovery agent	N.A.	Investigative	[43]
1-(3,4-Dichloro-phenyl)-3-diethylamino-indan-5-ol	DMN4JU0	Discovery agent	N.A.	Investigative	[45]
1-(3,4-Dichloro-phenyl)-3-methylamino-indan-5-ol	DMWIEDN	Discovery agent	N.A.	Investigative	[45]
1-(3-bromophenyl)-2-(tert-butylamino)propan-1-one	DM2SEXH	Discovery agent	N.A.	Investigative	[46]
1-(3-chlorophenyl)-2-(dimethylamino)propan-1-one	DMFYJ5V	Discovery agent	N.A.	Investigative	[46]
1-(3-chlorophenyl)-2-(piperidin-1-yl)propan-1-one	DMPOVUY	Discovery agent	N.A.	Investigative	[46]
1-(3-iodophenyl)-2-pyrrolidin-1-yl-pentan-1-one	DMPEZ1V	Discovery agent	N.A.	Investigative	[44]
1-(3-methylphenyl)-2-pyrrolidin-1-yl-pentan-1-one	DMB9T6F	Discovery agent	N.A.	Investigative	[44]
1-(4-aminophenyl)-2-pyrrolidin-1-yl-pentan-1-one	DMY7TDZ	Discovery agent	N.A.	Investigative	[47]
1-(4-bromophenyl)-2-(tert-butylamino)propan-1-one	DMW6YDK	Discovery agent	N.A.	Investigative	[46]
1-(4-bromophenyl)-2-pyrrolidin-1-yl-pentan-1-one	DMPLEC0	Discovery agent	N.A.	Investigative	[44]
1-(4-fluorophenyl)-2-pyrrolidin-1-yl-pentan-1-one	DM6ARQF	Discovery agent	N.A.	Investigative	[44]
1-(4-iodophenyl)-2-pyrrolidin-1-yl-pentan-1-one	DMBV8PT	Discovery agent	N.A.	Investigative	[44]
1-(4-nitrophenyl)-2-pyrrolidin-1-yl-pentan-1-one	DME435S	Discovery agent	N.A.	Investigative	[44]
1-(benzofuran-2-yl)-3-aza-bicyclo[3.1.0]hexane	DMGNL2A	Discovery agent	N.A.	Investigative	[32]
1-(naphthalen-2-yl)-3-aza-bicyclo[3.1.0]hexane	DMUEQC8	Discovery agent	N.A.	Investigative	[32]
1-(thiophen-2-yl)-3-aza-bicyclo[3.1.0]hexane	DM6J1AK	Discovery agent	N.A.	Investigative	[32]
1-Benzo[b]thiophen-2-yl-cycloheptylamine	DMMN5TA	Discovery agent	N.A.	Investigative	[40]
1-Benzo[b]thiophen-2-yl-cyclohexylamine	DMR97FU	Discovery agent	N.A.	Investigative	[40]
1-Benzo[b]thiophen-2-yl-cyclopentylamine	DM6EF1L	Discovery agent	N.A.	Investigative	[40]
1-benzylpiperidine hydrochloride	DM7GDEK	Discovery agent	N.A.	Investigative	[5]
1-Biphenyl-4-yl-3-aza-bicyclo[3.1.0]hexane	DM6E7TA	Discovery agent	N.A.	Investigative	[32]
1-naphthalen-2-yl-2-pyrrolidin-1-yl-pentan-1-one	DMU04ZQ	Discovery agent	N.A.	Investigative	[44]
1-phenyl-1-(piperidin-2-yl)propan-2-one	DM0DH98	Discovery agent	N.A.	Investigative	[37]
1-phenyl-3-aza-bicyclo[3.1.0]hexane	DMUA72F	Discovery agent	N.A.	Investigative	[32]
10R-hydroxylobel-7-ene	DM8XRCT	Discovery agent	N.A.	Investigative	[48]
10R-hydroxylobelane	DMN93QT	Discovery agent	N.A.	Investigative	[48]
10S-hydroxylobel-7-ene	DMN1YQ6	Discovery agent	N.A.	Investigative	[48]
10S-hydroxylobelane	DM54AKV	Discovery agent	N.A.	Investigative	[48]
1S,2R-milnacipran	DM7Y5AN	Discovery agent	N.A.	Investigative	[49]
2-((2-iodophenoxy)(phenyl)methyl)morpholine	DMS1AOK	Discovery agent	N.A.	Investigative	[50]
2-((3-iodophenyl)(o-tolyloxy)methyl)morpholine	DMS21CR	Discovery agent	N.A.	Investigative	[50]
2-(2'-Aminoethyl)-5-benzyltetrahydrofuran	DMVTD1F	Discovery agent	N.A.	Investigative	[51]
2-(2,3-Dihydro-1H-indol-5-yl)-1-methyl-ethylamine	DM56NK4	Discovery agent	N.A.	Investigative	[41]
2-(2-chlorophenoxy)-3-(piperidin-4-yl)pyridine	DM1ULEX	Discovery agent	N.A.	Investigative	[52]
2-(2-methoxyphenoxy)-3-(piperidin-4-yl)pyridine	DMYVDJQ	Discovery agent	N.A.	Investigative	[52]
2-(Aminomethyl)-5-(1'-naphthyl)tetrahydrofuran	DMCUTY9	Discovery agent	N.A.	Investigative	[51]
2-(Aminomethyl)-5-(2'-naphthyl)tetrahydrofuran	DM157SO	Discovery agent	N.A.	Investigative	[51]
2-(Aminomethyl)-5-phenethyltetrahydrofuran	DMEZ7O2	Discovery agent	N.A.	Investigative	[51]
2-(N,N-Diethylamino)-3'-chloropropiophenone	DMVR248	Discovery agent	N.A.	Investigative	[53]
2-(N-Cyclopentylamino)-3'-bromopropiophenone	DML4GHA	Discovery agent	N.A.	Investigative	[46]
2-(N-Cyclopentylamino)-3'-chloropropiophenone	DMP68CE	Discovery agent	N.A.	Investigative	[53]
2-(N-Cyclopentylamino)-3'-fluoropropiophenone	DMH6FKX	Discovery agent	N.A.	Investigative	[46]
2-(N-Cyclopentylamino)-3'-methoxypropiophenone	DMVN1UI	Discovery agent	N.A.	Investigative	[46]
2-(N-Cyclopentylamino)-3'-methylpropiophenone	DMG87RK	Discovery agent	N.A.	Investigative	[46]
2-(N-Cyclopropylamino)-3-chloropropiophenone	DMNMES3	Discovery agent	N.A.	Investigative	[53]
2-(N-Isopropylamino)-3'-chloropropiophenone	DMCK7SV	Discovery agent	N.A.	Investigative	[53]
2-(N-Pyrrolidinyl)-3'-bromopropiophenone	DM85ZCW	Discovery agent	N.A.	Investigative	[46]
2-(N-Pyrrolidinyl)-3'-fluoropropiophenone	DMYPOC5	Discovery agent	N.A.	Investigative	[46]
2-(N-Pyrrolidinyl)-3'-methoxypropiophenone	DM1W3L9	Discovery agent	N.A.	Investigative	[46]
2-(N-Pyrrolidinyl)-3'-methylpropiophenone	DMGKXOI	Discovery agent	N.A.	Investigative	[46]
2-(N-Pyrrolidinyl)-3'-nitropropiophenone	DM1I9LQ	Discovery agent	N.A.	Investigative	[46]
2-(N-tert-Butylamino)-3',4'-dichloropropiophenone	DMKIEVP	Discovery agent	N.A.	Investigative	[53]
2-(N-tert-Butylamino)-3'-chloroheptanophenone	DMY2PBO	Discovery agent	N.A.	Investigative	[53]
2-(N-tert-Butylamino)-3'-chlorohexanophenone	DMPO3CJ	Discovery agent	N.A.	Investigative	[53]
2-(N-tert-Butylamino)-3'-chlorooctanophenone	DMW47VA	Discovery agent	N.A.	Investigative	[53]
2-(N-tert-Butylamino)-3'-chloropentanophenone	DMTZ540	Discovery agent	N.A.	Investigative	[53]
2-(N-tert-Butylamino)-4'-chloropropiophenone	DME1SP4	Discovery agent	N.A.	Investigative	[53]
2-(N-tert-Butylamino)propiophenone	DM9E5LT	Discovery agent	N.A.	Investigative	[53]
2-(tert-butylamino)-1-(3-chlorophenyl)butan-1-one	DMI457Y	Discovery agent	N.A.	Investigative	[46]
2-(tert-butylamino)-1-m-tolylpropan-1-one	DM6PV4W	Discovery agent	N.A.	Investigative	[46]
2-(tert-butylamino)-1-p-tolylpropan-1-one	DMYFQDT	Discovery agent	N.A.	Investigative	[46]
2-(tert-Butylamino)-3',4'-dichlorobutyrophenone	DMOJK8Y	Discovery agent	N.A.	Investigative	[53]
2-(tert-Butylamino)-3',4'-dichloropentanophenone	DMMUDQ7	Discovery agent	N.A.	Investigative	[53]
2-(tert-Butylamino)-3',5'-difluoropropiophenone	DMH3QLF	Discovery agent	N.A.	Investigative	[53]
2-(tert-Butylamino)-3'-fluoropropiophenone	DM5YJP3	Discovery agent	N.A.	Investigative	[53]
2-Amino-1-(4-methylthiophenyl)propane	DMJ2Z9G	Discovery agent	N.A.	Investigative	[54]
2-Aminomethyl-5-(p-bromophenyl)tetrahydrofuran	DMCJUWK	Discovery agent	N.A.	Investigative	[51]
2-Aminomethyl-5-(p-chlorophenyl)tetrahydrofuran	DM3OTZY	Discovery agent	N.A.	Investigative	[51]
2-Aminomethyl-5-(p-methoxyphenyl)tetrahydrofuran	DMDG8FL	Discovery agent	N.A.	Investigative	[51]
2-Aminomethyl-5-(p-t-butylphenyl)tetrahydrofuran	DME4P7K	Discovery agent	N.A.	Investigative	[51]
2-Aminomethyl-5-(phenyl)tetrahydrofuran	DM413ZB	Discovery agent	N.A.	Investigative	[51]
2-phenoxy-3-(piperidin-4-yl)pyridine	DM6JNT5	Discovery agent	N.A.	Investigative	[52]
2-phenylpiperidine hydrochloride	DM7OHSX	Discovery agent	N.A.	Investigative	[5]
2pyrrolidin-1-yl-1-phenylpentan-1-one	DMBJXCF	Discovery agent	N.A.	Investigative	[44]
3-(2-phenyl-2-(piperazin-1-yl)ethyl)phenol	DM6QZTB	Discovery agent	N.A.	Investigative	[42]
3-(3,4-dichlorophenyl)-2-nortropene	DMT3AW8	Discovery agent	N.A.	Investigative	[55]
3-(4-Chlorophenyl)-2-nortropene	DM71EUO	Discovery agent	N.A.	Investigative	[55]
3-(4-Fluorophenyl)-2-nortropene	DM8CK9M	Discovery agent	N.A.	Investigative	[55]
3-(4-Trifluoromethylphenyl)-2-nortropene	DMZB804	Discovery agent	N.A.	Investigative	[55]
3-alpha-Phenylmethoxy-3-beta-phenyl-nortropane	DMO5IJA	Discovery agent	N.A.	Investigative	[55]
3-p-Tolyl-8-aza-bicyclo[3.2.1]octane	DM0872E	Discovery agent	N.A.	Investigative	[56]
3-Phenyl-2-nortropene	DMAJMU6	Discovery agent	N.A.	Investigative	[55]
3alpha-(bis-chloro-phenylmethoxy)tropane	DMBUZWQ	Discovery agent	N.A.	Investigative	[57]
4-(1H-indol-3-yl)-N,N-dimethylcyclohex-3-enamine	DM7Y1ZD	Discovery agent	N.A.	Investigative	[58]
4-(2-((3-fluorophenoxy)methyl)phenyl)piperidine	DMJ9CNA	Discovery agent	N.A.	Investigative	[43]
4-(2-(2-fluoro-5-methylphenoxy)phenyl)piperidine	DM9UA0N	Discovery agent	N.A.	Investigative	[43]
4-(2-(2-fluorobenzyloxy)phenyl)piperidine	DMCR3VM	Discovery agent	N.A.	Investigative	[43]
4-(2-(3-chlorophenoxy)phenyl)piperidine	DM0IT5E	Discovery agent	N.A.	Investigative	[43]
4-(2-(3-fluorophenoxy)-4-methylphenyl)piperidine	DMEPB9L	Discovery agent	N.A.	Investigative	[43]
4-(2-(3-fluorophenoxy)phenyl)piperidine	DMZMEOG	Discovery agent	N.A.	Investigative	[43]
4-(2-(4-fluorobenzyloxy)phenyl)piperidine	DM29QLG	Discovery agent	N.A.	Investigative	[43]
4-(2-(4-fluorophenoxy)-4-methylphenyl)piperidine	DMJNB8C	Discovery agent	N.A.	Investigative	[43]
4-(2-(4-fluorophenoxy)phenyl)piperidine	DMFQT9O	Discovery agent	N.A.	Investigative	[43]
4-(2-(benzyloxy)-3-fluorophenyl)piperidine	DMM2NHZ	Discovery agent	N.A.	Investigative	[43]
4-(2-(benzyloxy)-6-fluorophenyl)piperidine	DMF3S50	Discovery agent	N.A.	Investigative	[43]
4-(2-(benzyloxy)phenyl)piperidine	DMOC7PY	Discovery agent	N.A.	Investigative	[43]
4-(2-(phenoxymethyl)phenyl)piperidine	DM0OFRQ	Discovery agent	N.A.	Investigative	[43]
4-(2-fluoro-6-(2-fluorophenoxy)phenyl)piperidine	DMQUAP2	Discovery agent	N.A.	Investigative	[52]
4-(2-fluoro-6-(3-fluorophenoxy)phenyl)piperidine	DMUBHRF	Discovery agent	N.A.	Investigative	[43]
4-(2-fluoro-6-(4-fluorophenoxy)phenyl)piperidine	DMJ2GW0	Discovery agent	N.A.	Investigative	[43]
4-(2-fluoro-6-phenoxyphenyl)piperidine	DMXIGWC	Discovery agent	N.A.	Investigative	[43]
4-(2-phenoxyphenyl)piperidine	DMB5IFA	Discovery agent	N.A.	Investigative	[43]
4-(2-pyrrolidin-1-yl-pentanoyl)benzonitrile	DMOSDAN	Discovery agent	N.A.	Investigative	[44]
4-(3-fluoro-2-phenoxyphenyl)piperidine	DM1C3NZ	Discovery agent	N.A.	Investigative	[43]
4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one	DMM9X0G	Discovery agent	N.A.	Investigative	[59]
4-[(diphenylmethyl)amino]-2-phenylquinazoline	DMT1PM4	Discovery agent	N.A.	Investigative	[28]
6-(3-aza-bicyclo[3.1.0]hexan-1-yl)quinoline	DMKFDQ7	Discovery agent	N.A.	Investigative	[32]
6-(piperidin-4-ylmethoxy)-2-naphthonitrile	DMBQKGY	Discovery agent	N.A.	Investigative	[26]
7-(piperidin-4-ylmethoxy)-2-naphthonitrile	DM6I5K1	Discovery agent	N.A.	Investigative	[26]
8-Methyl-3-p-tolyl-8-aza-bicyclo[3.2.1]octane	DMOM4VS	Discovery agent	N.A.	Investigative	[56]
8R-hydroxylobel-9-ene	DML9HDA	Discovery agent	N.A.	Investigative	[60]
8R-hydroxylobelane	DMJ82TO	Discovery agent	N.A.	Investigative	[48]
8S-hydroxylobel-9-ene	DMRL3BK	Discovery agent	N.A.	Investigative	[48]
8S-hydroxylobelane	DMLONTS	Discovery agent	N.A.	Investigative	[48]
AMINOBENZTROPINE	DMT13EW	Discovery agent	N.A.	Investigative	[61]
ANOLOBINE	DM6DYZ0	Discovery agent	N.A.	Investigative	[62]
ANONAINE	DMM5PEV	Discovery agent	N.A.	Investigative	[62]
ANTIOQUINE	DMUESP8	Discovery agent	N.A.	Investigative	[62]
Benzyl-(2-phenyl-quinazolin-4-yl)-amine	DM3X50C	Discovery agent	N.A.	Investigative	[28]
Beta-methoxyamphetamine	DMA9CSG	Discovery agent	N.A.	Investigative	[63]
Bip-tyr(3bzl)-thr-pro-lys-thr	DM4FSXK	Discovery agent	N.A.	Investigative	[64]
Bip-tyr-ala-pro-lys-thr(obzl)-gly	DM0VKA2	Discovery agent	N.A.	Investigative	[64]
Bip-tyr-thr-ala-pro-phe	DMUWE81	Discovery agent	N.A.	Investigative	[64]
Bip-tyr-thr-pro-ala-thr(obzl)-gly	DMN38JC	Discovery agent	N.A.	Investigative	[64]
Bip-tyr-thr-pro-lys-thr	DM7EKH3	Discovery agent	N.A.	Investigative	[64]
Bip-tyr-thr-pro-lys-thr(obzl)-gly	DMAPX9G	Discovery agent	N.A.	Investigative	[64]
Bip-tyr-thr-pro-thr(obzl)-gly	DM4CZ5B	Discovery agent	N.A.	Investigative	[64]
Biphenyl-2-ylmethyl-(S)-pyrrolidin-3-yl-amine	DM4D7V6	Discovery agent	N.A.	Investigative	[65]
Cis-3-phenoxy-2,3-dihydro-1H-inden-1-amine	DMTH4BG	Discovery agent	N.A.	Investigative	[66]
COCAINE.HCL	DMJRSIF	Discovery agent	N.A.	Investigative	[5]
COCLAURINE	DMZ1VSI	Discovery agent	N.A.	Investigative	[62]
D-166A	DMQJD4P	Discovery agent	N.A.	Investigative	[67]
D-211A	DMIBOAK	Discovery agent	N.A.	Investigative	[67]
D-211B	DM54CKZ	Discovery agent	N.A.	Investigative	[67]
D-254C	DM6KFCO	Discovery agent	N.A.	Investigative	[67]
D-257A	DMN7E6Y	Discovery agent	N.A.	Investigative	[67]
D-257C	DM5GLJ2	Discovery agent	N.A.	Investigative	[67]
Difluorobenztropine	DM8ABD6	Discovery agent	N.A.	Investigative	[57]
DIMETHYLGRISABINE	DMW0MTV	Discovery agent	N.A.	Investigative	[62]
Erythro-3,4-dichloromethylphenidate hydrochloride	DM8UVI3	Discovery agent	N.A.	Investigative	[5]
GB-12819	DM7B5HA	Discovery agent	N.A.	Investigative	[68]
HOMOAROMOLINE	DMIHFQY	Discovery agent	N.A.	Investigative	[62]
Indatraline	DMIP9DN	Discovery agent	N.A.	Investigative	[69]
ISOPILINE	DM9ERD6	Discovery agent	N.A.	Investigative	[62]
ISOTETRANDRINE	DM21K0E	Discovery agent	N.A.	Investigative	[62]
Methyl 2-(naphthalen-2-yl)benzoate	DMF6MRS	Discovery agent	N.A.	Investigative	[70]
METHYLENEDIOXYAMPHETAMINE	DMP204G	Discovery agent	N.A.	Investigative	[71]
METHYLENEDIOXYMETHAMPHETAMINE	DMYVU47	Discovery agent	N.A.	Investigative	[72]
MMDA	DMUWVGP	Discovery agent	N.A.	Investigative	[73]
N,Ndimethyl milnacipran	DMTWK7L	Discovery agent	N.A.	Investigative	[74]
N-Benzylmethylphenidate	DMDZ5XI	Discovery agent	N.A.	Investigative	[27]
NISOXETINE	DMZBNH0	Discovery agent	N.A.	Investigative	[66]
NORBOLDINE	DM6BNQR	Discovery agent	N.A.	Investigative	[62]
NORSTEPHALAGINE	DM1VIHC	Discovery agent	N.A.	Investigative	[62]
O-2442	DMK8AGF	Cocaine addiction	6C45.2	Investigative	[9]
O-methyldauricine	DMKTA5R	Discovery agent	N.A.	Investigative	[62]
OBABERINE	DMY4PMN	Discovery agent	N.A.	Investigative	[62]
Para-chloroamphetamine	DMOH75D	Discovery agent	N.A.	Investigative	[54]
PF-18298	DMJMU09	Discovery agent	N.A.	Investigative	[33]
PF-3409409	DMEZA0T	Attention deficit hyperactivity disorder	6A05.Z	Investigative	[75]
PF-526014	DMD8QOZ	Discovery agent	N.A.	Investigative	[33]
PMID25037917C58	DMJPR8M	Discovery agent	N.A.	Investigative	[76]
PSEUDOCOCAINE	DMN5AE8	Discovery agent	N.A.	Investigative	[77]
PYROVALERONE	DMV48S2	Discovery agent	N.A.	Investigative	[47]
R-226161	DM4BP7S	Discovery agent	N.A.	Investigative	[78]
R-NORDULOXETINE	DMGV4DS	Discovery agent	N.A.	Investigative	[79]
RTI-219	DM2QYXN	Discovery agent	N.A.	Investigative	[80]
SECOCULARIDINE	DM76CUP	Discovery agent	N.A.	Investigative	[62]
Threo-1-aza-5-phenyl[4.4.0]decane hydrochloride	DM4W1E8	Discovery agent	N.A.	Investigative	[5]
Threo-3,4-dichlororitalinol hydrochloride	DMA7GTH	N. A.	N. A.	Investigative	[5]
Threo-N-ethylritalinol hydrochloride	DMEVT7S	N. A.	N. A.	Investigative	[5]
Threo-ritalinol hydrochloride	DM4MPVE	N. A.	N. A.	Investigative	[5]
Threo-ritalinol methyl ether hydrochloride	DMV0CZ5	N. A.	N. A.	Investigative	[5]
Trans-3-(o-tolyloxy)-2,3-dihydro-1H-inden-1-amine	DMEDC5I	Discovery agent	N.A.	Investigative	[66]
WIN-35065	DM6IH4F	Discovery agent	N.A.	Investigative	[80]
WIN-35066-2	DMOX1S0	N. A.	N. A.	Investigative	[81]
[3-(3,4-Dichloro-phenyl)-indan-1-yl]-methyl-amine	DM4BYEQ	Discovery agent	N.A.	Investigative	[45]
[3H]GBR12935	DMGQDLU	Discovery agent	N.A.	Investigative	[82]
[3H]WIN35428	DMI8RU0	Discovery agent	N.A.	Investigative	[82]
[N-[2-[(3'-N'-PROPYL-3''ALPHA-(BIS(4-FLUORORPHENYL)METHOXY)TROPANE-2''BETA-CARBOXYLIC ACID METHYL ESTER)(2-MERCAPTOETHYL)AMINO]ACETYL]-2-AMINOETHANETHIOLATO]RHENIUM(V) OXIDE (DIASTEREOMERIC MIX)	DMW9AST	Discovery agent	N.A.	Investigative	[83]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Major depressive disorder	6A20	Pre-frontal cortex	4.17E-01	4.04E-03	0.02
Parkinson's disease	8A00.0	Substantia nigra tissue	1.08E-03	-3.08	-1.99

The Drug Transporter (DTP) Role of This DTT

• DTT DTP Name: Sodium-dependent dopamine transporter (SLC6A3) DTP Info
• Gene Name: SLC6A3

5 Approved Drug(s) Transported by This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Amphetamine	DMSZQAK	Attention deficit hyperactivity disorder	6A05.Z	Approved	[84]
Benztropine	DMGZOVN	Parkinson disease	8A00.0	Approved	[85]
Bretylium	DM1FX74	Long QT syndrome	BC65.0	Approved	[86]
Dopamine	DMPGUCF	Acromegaly	5A60.0	Approved	[87]
OPC-34712	DMHG57U	Major depressive disorder	6A70.3	Approved	[88]

References

• [1] Imaging the effects of methylphenidate on brain dopamine: new model on its therapeutic actions for attention-deficit/hyperactivity disorder. Biol Psychiatry. 2005 Jun 1;57(11):1410-5.
• [2] Rapid detection of Parkinson's disease by SPECT with altropane: a selective ligand for dopamine transporters. Synapse. 1998 Jun;29(2):128-41.
• [3] Differential involvement of the norepinephrine, serotonin and dopamine reuptake transporter proteins in cocaine-induced taste aversion. Pharmacol Biochem Behav. 2009 Jul;93(1):75-81.
• [4] Dasotraline for the Treatment of Attention-Deficit/Hyperactivity Disorder: A Randomized, Double-Blind, Placebo-Controlled, Proof-of-Concept Trial in Adults. Neuropsychopharmacology. 2015 Nov;40(12):2745-52.
• [5] Synthesis and pharmacology of site-specific cocaine abuse treatment agents: restricted rotation analogues of methylphenidate. J Med Chem. 2007 May 31;50(11):2718-31.
• [6] Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
• [7] Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
• [8] Interaction of the anorectic medication, phendimetrazine, and its metabolites with monoamine transporters in rat brain. Eur J Pharmacol. 2002 Jun 28;447(1):51-7.
• [9] URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 927).
• [10] Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
• [11] Novel drugs and therapeutic targets for severe mood disorders. Neuropsychopharmacology. 2008 Aug;33(9):2080-92.
• [12] Emerging drugs in neuropathic pain. Expert Opin Emerg Drugs. 2007 Mar;12(1):113-26.
• [13] Monoamine transporter occupancy of a novel triple reuptake inhibitor in baboons and humans using positron emission tomography. J Pharmacol Exp Ther. 2013 Aug;346(2):311-7.
• [14] Development of the dopamine transporter selective RTI-336 as a pharmacotherapy for cocaine abuse.AAPS J.2006 Mar 24;8(1):E196-203.
• [15] Amineptine in the treatment of amphetamine withdrawal: a placebo-controlled, randomised, double-blind study. J Med Assoc Thai. 1997 Sep;80(9):587-92.
• [16] Pharmacogenetics and obesity: common gene variants influence weight loss response of the norepinephrine/dopamine transporter inhibitor GW320659 in obese subjects. Pharmacogenet Genomics. 2005 Dec;15(12):883-9.
• [17] Clinical pipeline report, company report or official report of Neurosearch.
• [18] Emerging drugs for bipolar disorder. Expert Opin Emerg Drugs. 2006 Nov;11(4):621-34.
• [19] Dopamine uptake inhibitor-induced rotation in 6-hydroxydopamine-lesioned rats involves both D1 and D2 receptors but is modulated through 5-hydroxyt... J Pharmacol Exp Ther. 2005 Mar;312(3):1124-31.
• [20] Treating Attention-Deficit/Hyperactivity Disorder in Adults: Focus on Once-Daily Medications. Prim Care Companion CNS Disord 2011.
• [21] NSD-644: Phase I started.NeuroSearch A/S (CSE:NEUR), Ballerup, Denmark, GlaxoSmithKline plc (LSE:GSK; GSK), London, U.K.
• [22] Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031598)
• [23] Emerging pharmacological strategies in the fight against cocaine addiction. Expert Opin Emerg Drugs. 2006 Mar;11(1):91-8.
• [24] Technepine: a high-affinity 99m-technetium probe to label the dopamine transporter in brain by SPECT imaging. Synapse. 1996 Mar;22(3):239-46.
• [25] Pridopidine selectively occupies sigma-1 rather than dopamine D2 receptors at behaviorally active doses. Psychopharmacology (Berl). 2015 Sep;232(18):3443-53.
• [26] Design and optimization of selective serotonin re-uptake inhibitors with high synthetic accessibility. Part 1. Bioorg Med Chem Lett. 2009 Apr 15;19(8):2329-32.
• [27] Quantitative structure-activity relationship studies of threo-methylphenidate analogs. Bioorg Med Chem. 2010 Oct 15;18(20):7221-38.
• [28] Identification of a novel partial inhibitor of dopamine transporter among 4-substituted 2-phenylquinazolines. Bioorg Med Chem Lett. 2002 Aug 19;12(16):2225-8.
• [29] New iodoreboxetine analogues for SPECT imaging of the noradrenaline transporter. Bioorg Med Chem Lett. 2008 Sep 15;18(18):4940-3.
• [30] Design and synthesis of (2R,3S)-iodoreboxetine analogues for SPECT imaging of the noradrenaline transporter. Bioorg Med Chem Lett. 2009 Sep 1;19(17):4996-8.
• [31] Synthesis and characterization of in vitro and in vivo profiles of hydroxybupropion analogues: aids to smoking cessation. J Med Chem. 2010 Jun 24;53(12):4731-48.
• [32] Studies on the structure-activity relationship of bicifadine analogs as monoamine transporter inhibitors. Bioorg Med Chem Lett. 2008 Jul 1;18(13):3682-6.
• [33] Second generation N-(1,2-diphenylethyl)piperazines as dual serotonin and noradrenaline reuptake inhibitors: improving metabolic stability and reduc... Bioorg Med Chem Lett. 2010 Jun 15;20(12):3788-92.
• [34] 1-Naphthyl and 4-indolyl arylalkylamines as selective monoamine reuptake inhibitors. Bioorg Med Chem Lett. 2009 Jan 1;19(1):58-61.
• [35] Bioorg Med Chem Lett. 2009 Oct 15;19(20):5893-7. Epub 2009 Aug 21.Design and optimisation of selective serotonin re-uptake inhibitors with high synthetic accessibility: part 2.
• [36] Stereoselective inhibition of serotonin re-uptake and phosphodiesterase by dual inhibitors as potential agents for depression. Bioorg Med Chem. 2009 Jan 1;17(1):337-43.
• [37] Slow-onset, long-duration, alkyl analogues of methylphenidate with enhanced selectivity for the dopamine transporter. J Med Chem. 2007 Jan 25;50(2):219-32.
• [38] Structure-activity relationships of N-substituted piperazine amine reuptake inhibitors. Bioorg Med Chem Lett. 2006 Aug 15;16(16):4349-53.
• [39] Identification of a potent, selective, and orally active leukotriene a4 hydrolase inhibitor with anti-inflammatory activity. J Med Chem. 2008 Jul 24;51(14):4150-69.
• [40] Synthesis and biological evaluation of 1-[1-(2-benzo[b]thienyl)cyclohexyl]piperidine homologues at dopamine-uptake and phencyclidine- and sigma-bin... J Med Chem. 1993 Apr 30;36(9):1188-93.
• [41] Selective monoamine oxidase inhibitors. 3. Cyclic compounds related to 4-aminophenethylamine. Preparation and neuron-selective action of some 5-(2-... J Med Chem. 1986 Aug;29(8):1406-12.
• [42] N-(1,2-diphenylethyl)piperazines: a new class of dual serotonin/noradrenaline reuptake inhibitor. Bioorg Med Chem Lett. 2006 Aug 15;16(16):4345-8.
• [43] Discovery and pharmacological characterization of aryl piperazine and piperidine ethers as dual acting norepinephrine reuptake inhibitors and 5-HT1... Bioorg Med Chem Lett. 2009 Dec 1;19(23):6604-7.
• [44] 1-(4-Methylphenyl)-2-pyrrolidin-1-yl-pentan-1-one (Pyrovalerone) analogues: a promising class of monoamine uptake inhibitors. J Med Chem. 2006 Feb 23;49(4):1420-32.
• [45] Synthesis and pharmacological evaluation of 3-(3,4-dichlorophenyl)-1-indanamine derivatives as nonselective ligands for biogenic amine transporters. J Med Chem. 2004 May 6;47(10):2624-34.
• [46] Synthesis and biological evaluation of bupropion analogues as potential pharmacotherapies for smoking cessation. J Med Chem. 2010 Mar 11;53(5):2204-14.
• [47] A novel photoaffinity ligand for the dopamine transporter based on pyrovalerone. Bioorg Med Chem. 2009 Jun 1;17(11):3770-4.
• [48] Des-keto lobeline analogs with increased potency and selectivity at dopamine and serotonin transporters. Bioorg Med Chem Lett. 2006 Oct 1;16(19):5018-21.
• [49] Characterization of thien-2-yl 1S,2R-milnacipran analogues as potent norepinephrine/serotonin transporter inhibitors for the treatment of neuropath... J Med Chem. 2008 Nov 27;51(22):7265-72.
• [50] Development of SPECT imaging agents for the norepinephrine transporters: [123I]INER. Bioorg Med Chem Lett. 2007 Jan 15;17(2):533-7.
• [51] 2,5-Disubstituted tetrahydrofurans as selective serotonin re-uptake inhibitors. Bioorg Med Chem. 2009 Mar 1;17(5):2047-68.
• [52] Design, synthesis, and pharmacological evaluation of phenoxy pyridyl derivatives as dual norepinephrine reuptake inhibitors and 5-HT1A partial agon... Bioorg Med Chem Lett. 2010 Feb 1;20(3):1114-7.
• [53] Synthesis and biological evaluation of bupropion analogues as potential pharmacotherapies for cocaine addiction. J Med Chem. 2009 Nov 12;52(21):6768-81.
• [54] Synthesis and serotonin transporter activity of sulphur-substituted alpha-alkyl phenethylamines as a new class of anticancer agents. Eur J Med Chem. 2009 Dec;44(12):4862-88.
• [55] Synthesis and monoamine transporter affinity of 3alpha-arylmethoxy-3beta-arylnortropanes. Bioorg Med Chem Lett. 2009 Dec 15;19(24):6865-8.
• [56] 3alpha-(4-Substituted phenyl)nortropane-2beta-carboxylic acid methyl esters show selective binding at the norepinephrine transporter. Bioorg Med Chem Lett. 2000 Nov 6;10(21):2445-7.
• [57] Structure-activity relationship studies on a novel series of (S)-2beta-substituted 3alpha-[bis(4-fluoro- or 4-chlorophenyl)methoxy]tropane analogue... J Med Chem. 2006 Oct 19;49(21):6391-9.
• [58] Conformationally restricted homotryptamines 3. Indole tetrahydropyridines and cyclohexenylamines as selective serotonin reuptake inhibitors. Bioorg Med Chem Lett. 2007 Jun 1;17(11):3099-104.
• [59] Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 rec... J Med Chem. 2010 Sep 9;53(17):6386-97.
• [60] Lobeline esters as novel ligands for neuronal nicotinic acetylcholine receptors and neurotransmitter transporters. Bioorg Med Chem. 2010 Jan 15;18(2):640-9.
• [61] 3'-Chloro-3 alpha-(diphenylmethoxy)tropane but not 4'-chloro-3 alpha-(diphenylmethoxy)tropane produces a cocaine-like behavioral profile. J Med Chem. 1997 Mar 14;40(6):851-7.
• [62] Effects of various isoquinoline alkaloids on in vitro 3H-dopamine uptake by rat striatal synaptosomes. J Nat Prod. 1995 Oct;58(10):1475-84.
• [63] Differential behavioural and neurochemical effects of para-methoxyamphetamine and 3,4-methylenedioxymethamphetamine in the rat. Prog Neuropsychopharmacol Biol Psychiatry. 2000 Aug;24(6):955-77.
• [64] Development of peptidic dopamine transporter inhibitors via aromatic modification-mediated conformational restriction. J Med Chem. 2006 Jul 13;49(14):4048-51.
• [65] Derivatives of (3S)-N-(biphenyl-2-ylmethyl)pyrrolidin-3-amine as selective noradrenaline reuptake inhibitors: Reducing P-gp mediated efflux by modu... Bioorg Med Chem Lett. 2008 Aug 1;18(15):4355-9.
• [66] Discovery of a potent, selective, and less flexible selective norepinephrine reuptake inhibitor (sNRI). Bioorg Med Chem Lett. 2008 Jul 15;18(14):4224-7.
• [67] Further structural optimization of cis-(6-benzhydryl-piperidin-3-yl)-benzylamine and 1,4-diazabicyclo[3.3.1]nonane derivatives by introducing an ex... Bioorg Med Chem. 2008 Mar 15;16(6):2769-78.
• [68] Synthesis and dopamine transporter binding affinities of 3alpha-benzyl-8-(diarylmethoxyethyl)-8-azabicyclo[3.2.1]octanes. Bioorg Med Chem Lett. 2002 Sep 2;12(17):2387-90.
• [69] Effects of indatraline and buprenorphine on self-administration of speedball combinations of cocaine and heroin by rhesus monkeys. Neuropsychopharmacology. 2001 Jul;25(1):104-17.
• [70] Synthesis, inhibition and binding of simple non-nitrogen inhibitors of monoamine transporters. Bioorg Med Chem. 2007 Jun 15;15(12):4159-74.
• [71] Synthesis and in vitro toxicity of 4-MTA, its characteristic clandestine synthesis byproducts and related sulfur substituted alpha-alkylthioampheta... Bioorg Med Chem. 2010 Jun 1;18(11):4009-31.
• [72] The origin of MDMA (ecstasy) revisited: the true story reconstructed from the original documents. Addiction. 2006 Sep;101(9):1241-5.
• [73] How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
• [74] Studies on the SAR and pharmacophore of milnacipran derivatives as monoamine transporter inhibitors. Bioorg Med Chem Lett. 2008 Feb 15;18(4):1346-9.
• [75] Design, synthesis and evaluation of N-[(3S)-pyrrolidin-3-yl]benzamides as selective noradrenaline reuptake inhibitors: CNS penetration in a more po... Bioorg Med Chem Lett. 2009 Aug 15;19(16):4579-83.
• [76] Novel inhibitors of the high-affinity L-proline transporter as potential therapeutic agents for the treatment of cognitive disorders. Bioorg Med Chem Lett. 2014 Aug 15;24(16):3886-90.
• [77] Synthesis of 8-Oxa analogues of norcocaine endowed with interesting cocaine-like activity. Bioorg Med Chem Lett. 1999 Jul 5;9(13):1831-6.
• [78] Tricyclic isoxazolines: identification of R226161 as a potential new antidepressant that combines potent serotonin reuptake inhibition and alpha2-a... Bioorg Med Chem. 2007 Jun 1;15(11):3649-60.
• [79] Inhibition of serotonin and norepinephrine reuptake and inhibition of phosphodiesterase by multi-target inhibitors as potential agents for depression. Bioorg Med Chem. 2009 Oct 1;17(19):6890-7.
• [80] Synthesis, monoamine transporter binding, properties, and functional monoamine uptake activity of 3beta-[4-methylphenyl and 4-chlorophenyl]-2 beta-... J Med Chem. 2007 Jul 26;50(15):3686-95.
• [81] Monoamine transporter binding, locomotor activity, and drug discrimination properties of 3-(4-substituted-phenyl)tropane-2-carboxylic acid methyl e... J Med Chem. 2004 Dec 2;47(25):6401-9.
• [82] Pharmacological heterogeneity of the cloned and native human dopamine transporter: disassociation of [3H]WIN 35,428 and [3H]GBR 12,935 binding. Mol Pharmacol. 1994 Jan;45(1):125-35.
• [83] A technetium-99m SPECT imaging agent which targets the dopamine transporter in primate brain. J Med Chem. 1997 Jun 6;40(12):1835-44.
• [84] Amphetamines, new psychoactive drugs and the monoamine transporter cycle. Trends Pharmacol Sci. 2015 Jan;36(1):41-50.
• [85] Pharmacological characterization of a dopamine transporter ligand that functions as a cocaine antagonist. J Pharmacol Exp Ther. 2014 Jan;348(1):106-15.
• [86] Which form of dopamine is the substrate for the human dopamine transporter: the cationic or the uncharged species? J Biol Chem. 1999 Feb 19;274(8):4876-82.
• [87] Characterization of VNTRs Within the Entire Region of SLC6A3 and Its Association with Hypertension. DNA Cell Biol. 2017 Mar;36(3):227-236.
• [88] Brexpiprazole reduces hyperactivity, impulsivity, and risk-preference behavior in mice with dopamine transporter knockdown-a model of mania. Psychopharmacology (Berl). 2017 Mar;234(6):1017-1028.